KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_0480Help
Entry
LM5578_0480       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00250  Alanine, aspartate and glutamate metabolism
lmn00410  beta-Alanine metabolism
lmn00430  Taurine and hypotaurine metabolism
lmn00650  Butanoate metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
lmn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LM5578_0480
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LM5578_0480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LM5578_0480
   00430 Taurine and hypotaurine metabolism
    LM5578_0480
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LM5578_0480
Enzymes [BR:lmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LM5578_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADB67236
LinkDB All DBs
Position
487079..488467
Genome map
AA seq 462 aa AA seqDB search
MFKTNVEQNNVPVFGSFESGQDLPEKRMNKESVDPRIAYQLVKDQLIDEGSARQNLATFC
QTYMEPEAEQIMAETMEKNAIDKSEYPQTAKLESSCVNMLADLWNVDESEHYMGTSTVGS
SEACMLGGMAMKFRWRSAALKNGLDIHAKKPNLVISSGYQVCWEKFCVYWDIELREVPMS
EEHLSINTDIIMDYVDEYTIGIVGILGITYTGKFDDIMTLNDLVEDYNNTHDNEVVIHVD
GASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGVGWILWRDKEYLPEELVFDV
SYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIHMRTRDGALQLSQAVAETGLF
EIYNDGANLPIVCYKLKDDANVAWTLYDLADRLQMKGWQVPAYPLPKEMGNTIIQRYVCR
GDLGQNMVTAFKNDLSESIEELNNAHILYHDVNTSKTHGFTH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaaatgttgaacaaaataatgtaccggtgtttggctcttttgagtcagga
caagatttaccagaaaaacgcatgaataaggaatctgtagatccaagaattgcttatcaa
cttgtgaaggatcaactgattgatgagggttcagcgagacaaaatctagctacgttctgt
caaacatatatggaaccggaagctgagcaaatcatggcagaaacgatggagaaaaatgct
attgataaatcagaatatccacagacagcaaagcttgagtctagttgtgtgaatatgttg
gcggatctttggaatgtggatgaatcggagcattacatgggaacgtcgacggttggttct
agtgaggcgtgtatgcttggtggaatggctatgaaatttagatggaggagtgctgcactc
aaaaatggattagacatccacgctaaaaaaccaaacttggttatttcttcaggctatcaa
gtttgttgggaaaagttctgtgtgtactgggatattgagttacgtgaagtaccgatgagt
gaggagcatttgagtatcaatacagatatcataatggactatgtagatgaatatacaatt
ggtattgtgggtattctgggcatcacctatacagggaaattcgacgatatcatgacttta
aatgaccttgtggaagactataataatacacatgacaatgaagttgtaattcatgttgac
ggtgcgagtggtgcaatgtttacaccgtttgttgagccgggtttagaatgggattttcga
ttaccaaatgttgtttcgattaatacatcagggcacaaatatggtcttgtatacccaggt
gtaggctggattttatggcgggacaaggaatatttgccagaagaattagtgtttgatgtg
agctatcttggtgggcatatgcctacgatggccatcaatttttccagaagtgcgagtcag
attatcggtcagtattataatttcttacgcttcggatatgagggttatcgtcaaattcat
atgcgtacaagagatggtgccttgcaattatcacaagctgttgcagaaacaggacttttc
gaaatttataacgatggcgcaaacttaccaatcgtatgttacaaactaaaagacgatgct
aatgtggcgtggacgctttatgacttggcagatcgcttacaaatgaaaggttggcaagta
ccggcgtatccacttccaaaagaaatgggtaacacaattattcaacgttacgtttgtcgc
ggcgatttaggacaaaatatggttacagctttcaaaaacgatttgagtgaaagtattgaa
gaactaaataacgctcatattttatatcatgatgtcaatacatctaaaacacatggcttt
actcattaa

DBGET integrated database retrieval system