KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1669Help
Entry
LM5578_1669       CDS       T01157                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00230  Purine metabolism
lmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LM5578_1669 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmn04147]
    LM5578_1669 (apt)
Enzymes [BR:lmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     LM5578_1669 (apt)
Exosome [BR:lmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM5578_1669 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ADB68417
LinkDB All DBs
Position
complement(1628834..1629355)
Genome map
AA seq 173 aa AA seqDB search
MEIKDLQDYVAIVNDWPKKGIVFKDITPLMNDGEAYRFATDKIVEYAKELKIDIIVGPEA
RGFIIGCPVAYALGIGFAPVRKPGKLPRETIEMEYDLEYGTNKLSMHSDAIKPGQRVLIT
DDLLATGGTIEATIKLVEELGGIVAGCAFLIELKELEGHKKLNGYDRLILMKL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagatttacaagattatgtagcgattgtgaacgattggccgaaaaaagga
attgtgtttaaagacatcacgccccttatgaatgacggagaagcatatcgttttgctaca
gataaaattgttgaatacgcaaaagaattaaaaattgatattattgttgggccggaagca
cgtggctttattatcggctgcccagttgcttatgcgctaggaattggttttgcacctgtt
cgcaaaccaggaaaacttcctcgtgaaacaatcgaaatggaatacgatttagaatatggt
actaataaattgtctatgcatagcgatgccatcaaaccgggtcaacgcgtgctaattaca
gatgatttactcgcaactggtggaacaatcgaagcgacaattaaactagtggaagaacta
ggtggtattgttgctgggtgtgcgttcttaatcgaactaaaagagctagaaggacacaaa
aaattaaatggttacgaccgtttaatccttatgaaattataa

DBGET integrated database retrieval system