KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1672Help
Entry
LM5578_1672       CDS       T01157                                 

Definition
(GenBank) bifunctional preprotein translocase subunit SecD/SecF
  KO
K12257  SecD/SecF fusion protein
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn02024  Quorum sensing
lmn03060  Protein export
lmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    LM5578_1672
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LM5578_1672
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LM5578_1672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmn02044]
    LM5578_1672
Secretion system [BR:lmn02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   LM5578_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG MMPL DUF1673
Motif
Other DBs
NCBI-ProteinID: ADB68420
LinkDB All DBs
Position
complement(1632242..1634506)
Genome map
AA seq 754 aa AA seqDB search
MVKKSKIVIFFLVVAIIFGAVFGTAKMVMQNINLGLDLQGGFEVLYEVSPADGKGTVSKQ
TLTDTVTSLDKRVNSLGVAEPSIQIEGNNRIRVQLAGVTDQAEARKMLSTTAQLSFRDAN
DKMMMNGSDLVAGGAKQAFDSSNNPIVTLKLKSADKFASVTKTILAEAPDNQLVIWLDWK
EGQKYKTEREKKDPAYLSAPNVSSVLDTDKVEISGSFTTEEAKDLAELLNSGALPVKMKE
VYSTSVGAQFGQDALQETILAGIIGVIAIFIFMMAVYRLPGVIACITLVAYTYLVLLILS
LLNATLTLPGIAGLILGIGMAVDANVITYERIKEEIKVGRSTKAAFEVGGKEAFRAILDG
NLTTLIVAAVLFYFGTSSIKGFATVLIISILVSFLTAVWGSRFLLGLLVKSNWLNNKPGF
FAVKRKDIHNLHEGINSFSLKTHFDRFDFVKHHRLFLSIFAVIVIVGIVILSIFKLNLGI
DFASGTRAEVTANQTLTETQIKKDLDAIDMPSDDIVFQGSGSKTAVVSYKGTLSQNDVAK
FKNYFEDKYKHEPSISTVSPTVGKELAKNGFWALGVASVLIVLYIAVRFEFYMGIAAILS
LLFDAFIIFIFFSVTRLEVDLTFIAAVLTVIGYSINDTIVTADRIRDISMKMQRFKTKEE
IADAVNKALRQTFTRSINTILTVIFTVLALVLFGSESILNFSIALLVGLVSSVFSSIFMA
MQLWYVFKARQLRKKGPISTVKKKKPRNNGQPVV
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagagtaagatagttattttctttctagtagttgcaattatctttggtgct
gtatttggtaccgcaaaaatggttatgcaaaacatcaacttaggcttggatcttcaaggg
ggattcgaagttctatatgaagtgtcaccagctgacggcaaagggactgtgtcgaaacaa
acgttgacagatacagtaacttcactcgataagcgtgttaattcattaggtgtagctgaa
ccgagtattcaaatcgaaggaaataaccgtatccgtgttcaacttgctggagtaactgac
caagcagaagcacgtaaaatgctatcgaccacagcccaattatcatttagagatgcaaat
gacaaaatgatgatgaatggtagtgacttggttgcaggcggtgctaaacaagcttttgat
tcaagcaataatccaatcgttacattaaaactaaaaagcgcagacaaatttgctagtgta
acaaaaacaatactagcagaagcgcctgacaatcaattagttatttggttagattggaaa
gaaggacaaaagtacaaaacagaacgcgaaaagaaagacccggcttacttatcagcacca
aacgtaagtagcgtattagatacagataaagtagagatttccggaagcttcacaacggaa
gaagcaaaagatttagctgaattgctaaactctggggcacttcctgtgaaaatgaaagag
gtttactctacatctgttggcgctcaatttggtcaagatgcattacaagaaactatttta
gctggtattattggggttattgctatctttattttcatgatggctgtttaccgtttacca
ggtgttattgcttgtatcactttagttgcatacacttatttagtactattaatactgagt
ctgcttaacgcaacacttactttaccagggattgcaggtttgattctggggataggtatg
gctgttgacgcgaacgtaataacctacgagcggataaaagaagaaatcaaagtcggtagg
tcgacgaaagcggcttttgaggtcggcggtaaagaagcattccgtgcgattttagatggt
aatttgacgacacttatcgtagctgcggttctcttctactttggaacaagctccatcaaa
ggttttgctacagtactaatcattagtattttagttagcttcttgacagccgtttgggga
tcaagattcttattaggcttattagtgaaaagtaattggcttaacaataaaccaggattc
tttgcggttaaacgaaaagatatccataatttacatgagggcattaatagctttagctta
aaaacacactttgaccgttttgactttgtaaaacatcatcgtctgttcttatctattttt
gctgtgattgttattgtcggtattgttattctatcgatcttcaaactaaatctaggtatt
gactttgccagtgggacacgagcggaagtaacagctaatcaaacactgacagaaacgcaa
attaagaaagatttagatgcgattgacatgccatcggatgatattgttttccaaggatct
ggttctaaaacagccgttgtttcttataaagggacattatcacaaaatgatgtagctaaa
ttcaaaaactactttgaggacaaatataagcacgaaccaagcattagtaccgtttcacca
actgtcggtaaagaacttgccaaaaatggcttctgggcactcggtgtggcgtctgtgttg
attgtactttatattgcggtccgatttgaattttatatgggtattgcggcgattctttcc
ttactattcgacgcatttatcatctttatctttttcagtgtaacaaggctggaggttgac
ttaaccttcattgccgcggtgctgacggttatcggttattccattaatgacacgatagtc
accgccgaccggatacgggatattagtatgaagatgcaacgtttcaaaacgaaagaagaa
attgcggatgctgttaataaagcattacgtcaaacattcactcgttcgattaataccatt
ttaacggttattttcaccgtacttgcacttgtactatttggtagtgagtctattctgaac
ttctccatcgccttacttgttggacttgtttctagtgtattctcctccatctttatggcg
atgcaattatggtacgtatttaaagcaagacaacttcgtaaaaaaggaccaattagcaca
gttaaaaagaaaaaaccacgtaataacggacaacctgtcgtataa

DBGET integrated database retrieval system