KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1675Help
Entry
LM5578_1675       CDS       T01157                                 

Gene name
tgt
Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmn03016]
    LM5578_1675 (tgt)
Enzymes [BR:lmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     LM5578_1675 (tgt)
Transfer RNA biogenesis [BR:lmn03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    LM5578_1675 (tgt)
 Prokaryotic Type
    LM5578_1675 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: ADB68423
LinkDB All DBs
Position
complement(1635403..1636542)
Genome map
AA seq 379 aa AA seqDB search
MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIIL
SNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHL
NGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHVR
PEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLP
ANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFR
PIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLAD
FREEFFEQYGFNRPDAKNF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccattcgttatgaactaattaaaacagataaacaaacaggtgctcgtcttggt
aaaatccatacaccgcacggcacatttgatacacctatgtttatgccagttggcacgctt
gcgacggtaaaaacaatgtcacccgaagaattaaaagccatgggtgcaggtattatttta
agcaatacgtatcatttatggttgcgtcccggagaagaacttattcgagaagcgggcgga
ctacataaatttatgaactgggatcaaccaatcttaacggattcaggtggttttcaggtg
tttagtttgagtaaaatgcgtgatatcaaagaagaaggcgttcatttccggaaccattta
aacggggacaaactattcttatcaccagaaaaagcgattcaaattcaaaatgcacttggt
tcggatattatgatgagttttgacgaatgtccaccatatccagcgtcgcatgaatatatg
aaaaaatcagtagaaagaacatctcgctgggctgaacgaggcttaaaagcgcacgttaga
ccagaagaccaaggtttgttcggtatcgtccaaggtggagcttacgaagatttacgtgcg
caaagtgcgaaagatctcgtttcgcttgattttcctggttattccatcggcggcttatca
gtaggggaaccaaaagatgtcatgaaccgcgttttggaacacacgacaccgctgttacca
gcgaacaaaccacgctatttaatgggtgtaggttcgcctgactcattgattgatggcgtg
attcgaggagtggacatgtttgactgtgttcttcccacacgtattgcacgaaatggtact
tgtatgacatctagtggtcgcttagttattaaaaacgctaagttcacacacgatttccgt
ccaattgatgaaaattgtgattgttatacatgtaaaaattactcgcgtgcatacatccga
cacttgattcgttgtgaagaaacatttggaattcgacttacaacttatcataatcttcat
tttctgttaaacttaatgaagcaagttcgtggcgctattatggaagatcgtcttgctgat
tttagggaagaattttttgagcaatatggattcaatcgtcctgatgcaaaaaatttctaa

DBGET integrated database retrieval system