KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0447Help
Entry
lmo0447           CDS       T00066                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00250  Alanine, aspartate and glutamate metabolism
lmo00410  beta-Alanine metabolism
lmo00430  Taurine and hypotaurine metabolism
lmo00650  Butanoate metabolism
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    lmo0447
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lmo0447
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lmo0447
   00430 Taurine and hypotaurine metabolism
    lmo0447
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lmo0447
Enzymes [BR:lmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     lmo0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 986724
NCBI-ProteinID: NP_463976
Pasteur: LMO00447
UniProt: Q9F5P3
LinkDB All DBs
Position
479765..481153
Genome map
AA seq 462 aa AA seqDB search
MFKTNVEQNNVPVFGSFESGQDLPEKRMNKESVDPRIAYQLVKDQLIDEGSARQNLATFC
QTYMEPEAEQIMAETMEKNAIDKSEYPQTAKLESSCVNMLADLWNVDESEHYMGTSTVGS
SEACMLGGMAMKFRWRSAALKNGLDIHAKKPSLVISSGYQVCWEKFCVYWDIELREVPMS
EEHLSINTDIIMDYVDEYTIGIVGILGITYTGKFDDIMTLNDLVEDYNNTHDNEVVIHVD
GASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGVGWILWRDKEYLPEELVFDV
SYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIHMRTRDGALQLSQAVAETGLF
EIYNDGANLPIVCYKLKDDANVAWTLYDLADRLQMKGWQVPAYPLPKEMGNTIIQRYVCR
GDLGQNMVTAFKNDLSESIEELNNAHILYHDVNTSKTHGFTH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaaatgttgaacaaaataatgtaccggtgtttggctcttttgagtcagga
caagatttaccagaaaaacgcatgaataaggaatctgtagatccaagaattgcttatcaa
cttgtgaaggatcaactgattgatgagggttcagcgagacaaaatctagctacgttctgt
caaacatatatggaaccggaagctgagcaaatcatggcagaaacgatggagaaaaatgct
attgataaatcagaatatccacagacagcaaagcttgagtctagttgtgtgaatatgttg
gcggatctttggaatgtggatgaatcggagcattacatgggaacgtcgacggttggttct
agtgaggcgtgtatgcttggtggaatggctatgaaatttagatggaggagtgctgcactc
aaaaatggattagacatccacgctaaaaaaccaagcttggttatttcttcaggctatcaa
gtttgttgggaaaagttctgtgtgtactgggatattgagttacgtgaagtaccgatgagt
gaggagcatttgagtatcaatacagatatcataatggactatgtagatgaatatacaatt
ggtattgtgggtattctgggcatcacctatacagggaaattcgacgatatcatgacttta
aatgaccttgtggaagactataataatacacatgacaatgaagttgtaattcatgttgac
ggtgcgagtggtgcaatgtttacaccgtttgttgagccgggtttagaatgggattttcga
ttaccaaatgttgtttcgattaatacatcagggcacaaatatggtcttgtatacccaggt
gtaggctggattttatggcgggacaaggaatatttgccagaagaattagtgtttgatgtg
agctatcttggtgggcatatgcctacgatggccatcaatttttccagaagtgcgagtcag
attatcggtcagtattataatttcttacgcttcggatatgagggttatcgtcaaattcat
atgcgtacaagagatggtgccttgcaattatcacaagctgttgcagaaacaggacttttc
gaaatttataacgatggcgcaaacttaccaatcgtatgttacaaactaaaagacgatgct
aatgtggcgtggacgctttatgacttggcagatcgcttacaaatgaaaggttggcaagta
ccggcgtatccacttccaaaagaaatgggtaacacaattattcaacgttacgtttgtcgc
ggcgatttaggacaaaatatggttacagctttcaaaaacgatttgagtgaaagtattgaa
gaactaaataacgctcatattttatatcatgatgtcaatacatctaaaacacatggcttt
actcattaa

DBGET integrated database retrieval system