KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0855Help
Entry
lmo0855           CDS       T00066                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00473  D-Alanine metabolism
lmo00550  Peptidoglycan biosynthesis
lmo01100  Metabolic pathways
lmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    lmo0855 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lmo0855 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lmo0855 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmo01011]
    lmo0855 (ddl)
Enzymes [BR:lmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     lmo0855 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lmo01011]
 Precursor biosynthesis
  Amino acid ligase
   lmo0855 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF2922
Motif
Other DBs
NCBI-GeneID: 985238
NCBI-ProteinID: NP_464381
Pasteur: LMO00855
UniProt: Q8Y8P1
LinkDB All DBs
Position
892662..893774
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQEEMVAEMEEVL
TYPVFVKPANLGSSVGISKATNKKELVDAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPEILEQMKEYAIQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaattaattttattatacggtggaaaatctgccgaacatgaagtttcatta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tatattacgaatgaaggtgagtggattcaaggaccacttctttctgggaagttagatttt
gtcgaacaattacgtttttcggctacagatacaataaaacttgctacaactgaatcagaa
aaatcagaaggggaagcaattagcccggccgttttagaagcagacggacaagagacagtc
gtattcccacttttacatggtccaaacggagaagatggcactgttcaaggattgttcgaa
gtattaaacattccatatgttggcaacggggtcttggcatcttctgctgcaatggacaaa
atcgtgatgaagaaaatttttgcagatgctggaatcccgcaagttccagcagttgctgtt
cgtttaattgattggaaaaattatcaagaggaaatggttgctgagatggaagaagtcctt
acatatcctgtcttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acaaacaaaaaagaattagtggacgcaatgacagaagcgtttttatatgaccgtcgtgtt
gttgttgaacaaggtgtcgttgctcgtgaaatcgaaatgggtgtacttggaaatgatacg
ccagtttgctctgtacctggcgaaattttgccagaaggtgcagttgccacattctacgat
tacaaagctaaatatcaagataacaatactgcgttaattattccgactgaagtagatcca
gaaatcttggaacaaatgaaagaatatgcgatccaagcgtttttaggtctggacgcaagc
ggactagtgcgagcggactttttcttaacggaagataatcagttattcttaaatgaagtg
aatacaatgccaggtttcacaccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgttaattgaacgattagtcgatttagcgaaagaacgccacgcagcc
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system