KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0970Help
Entry
lmo0970           CDS       T00066                                 

Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00061  Fatty acid biosynthesis
lmo00780  Biotin metabolism
lmo01100  Metabolic pathways
lmo01130  Biosynthesis of antibiotics
lmo01212  Fatty acid metabolism
Module
lmo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    lmo0970
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    lmo0970
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    lmo0970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmo01004]
    lmo0970
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     lmo0970
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     lmo0970
Lipid biosynthesis proteins [BR:lmo01004]
 Fatty acid synthase
  Component type
   lmo0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 987821
NCBI-ProteinID: NP_464495
Pasteur: LMO00970
UniProt: Q8Y8D5
LinkDB All DBs
Position
1001503..1002291
Genome map
AA seq 262 aa AA seqDB search
MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRAKKSITELVPSLSEVN
QNPLILACDVTSEEAITETFETIKDKAGKLSGLAHCIAFANKDFLTGDYLEVDRKSFLQA
HEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYNIMGVAKASLDASVRYLA
MDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPLKRATQAEEVGDTAYYLFS
NLSRGVTGEVIHVDSGYHIIGF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcattagagggaaaaacttatgttgtaatgggagtagctaataagcgtagt
attgcttgggcaattgcgcgttcactaaatgaagctggagcaaaactggtatttacatat
gcggacgatcgtgcgaaaaaaagcattacagagctagtaccttcattaagcgaagtaaat
caaaatccacttatcttagcttgtgatgtaacaagtgaagaagctattacagaaactttt
gaaacaattaaagataaagctggcaaacttagcggcctagcacactgcattgcttttgca
aacaaagactttttaactggggactatttagaagtagatcgtaaaagcttcttacaagca
catgaaattagtgcctattcatttacagctgtagctcgtgcactaaaacacttggaaatg
ttaacagaagatgcaagtttactaacgctaacttaccttggtggggaacgtgtagtagaa
aactataatattatgggtgtagcaaaagcttcccttgatgcaagcgttcgataccttgca
atggatctaggcgcaattggggttcgtgtgaatgctatttcagcaggaccaatcagaaca
gtatctgctcgtggcgttagcggtttctctgattctatttcactagtagaagaaagagct
ccactaaaacgtgcgacacaagcggaagaagttggcgatacagcgtattacttattcagt
aatttatctcgaggcgttactggtgaagtaattcatgtagatagcggttatcatattatt
ggattttaa

DBGET integrated database retrieval system