KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1439Help
Entry
lmo1439           CDS       T00066                                 

Gene name
sod
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Brite
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lmo1439 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4388
Motif
Other DBs
NCBI-GeneID: 986791
NCBI-ProteinID: NP_464964
Pasteur: LMO01439
UniProt: P28764
LinkDB All DBs
Position
complement(1472980..1473588)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIETFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaaccatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgcggaagaattagttactaac
ctagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcggtcatgct
aaccatacattgttctggtctattcttagcccaaatggtggcggcgctccaactggcaat
ttaaaagcagcaatcgaaagcgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagcagctgcagcacgttttggttctggttgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccattaagcgatggcaaaacacccgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaaccgtcgtcctgaa
tatatcgaaacattttggaatgttattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system