KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1818
Entry
lmo1818           CDS       T00066                                 

Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00030  Pentose phosphate pathway
lmo00040  Pentose and glucuronate interconversions
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01200  Carbon metabolism
lmo01230  Biosynthesis of amino acids
Module
lmo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lmo_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lmo1818
   00040 Pentose and glucuronate interconversions
    lmo1818
Enzymes [BR:lmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     lmo1818
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C PGM_PMM_II
Other DBs
NCBI-GeneID: 985908
NCBI-ProteinID: NP_465343
Pasteur: LMO01818
UniProt: Q8Y681
LinkDB
Position
complement(1891944..1892600)
AA seq 218 aa
MGKIAPSILSADFATLARDIKEVENCGADYIHIDVMDGHFVPNITFGPAVVQAIRPETKL
PLDVHLMIENPDTYIPEFAKAGADYITVHVEACTHLHRTLQLIRSYGVKAGAVLNPATPI
DVLQHVLNELDMVLFMTVNPGFGGQKFIPEVLEKISAFKEIVDKKGLDIEIEVDGGVDHE
TAKLCRDAGANVFVAGSYIYGNKNRQTPIDKLRAIVGE
NT seq 657 nt   +upstreamnt  +downstreamnt
atgggaaaaatagctccttcgattttaagtgcagactttgcaactcttgcaagagatatt
aaagaagtagaaaattgcggtgcagattacatccatattgacgttatggatggacatttc
gttccaaatattacatttggacctgctgttgtccaagccattcgtccagaaacgaaacta
ccacttgatgttcatttaatgattgaaaacccggatacatacattccagagtttgcaaaa
gcgggtgcagactacattaccgtgcatgtcgaagcttgtacgcatcttcatcgcacatta
caattaatccgttcttatggtgtgaaagccggagcagtacttaacccagcgacaccaatc
gatgttttacaacatgttttaaatgaactggatatggtcttatttatgacagtaaatcct
ggttttggcgggcaaaaattcatcccagaagtactagaaaaaattagtgctttcaaggaa
attgtggataaaaaaggcttagatatcgaaattgaagtagatggcggcgtggatcatgaa
acggcaaaattatgccgtgatgccggagcaaatgtatttgtagctggtagttacatttat
ggaaataaaaatcgccaaacaccaattgataaattacgtgccattgtaggcgagtaa

DBGET integrated database retrieval system