KEGG   Listeria monocytogenes ATCC 19117 (serotype 4d): LMOATCC19117_1517Help
Entry
LMOATCC19117_1517 CDS       T02239                                 

Definition
(GenBank) sensor histidine kinase
Organism
lmoa  Listeria monocytogenes ATCC 19117 (serotype 4d)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HAMP HATPase_c_5 ATG27
Motif
Other DBs
NCBI-ProteinID: CBY70416
LinkDB All DBs
Position
1530501..1531940
Genome map
AA seq 479 aa AA seqDB search
MKRMKFKYAYQLFFTQFIILLIACIMIGVLVSHSLKDYFYQSQVDDLTSYGQTISRDIRY
SPQDATMQVLNTYQRILDVKKIHYTIKNANDETIYPTQMNQPLPKDFSISSDDKKKLESG
ETVSKKIDNRFNKEMTIVYVPIMNGDKFVGSIVLNSPISGTEQVIGTINRYMFYTILLSI
TVALILSAILSKLQVNRINKLRAATKDVIQGNYKARLKENNFDEIGALAIDFNKMTQTLE
TSQEEIERQEKRRRQFIADVSHEMRTPLTTISGLTEGLVNDIIPKSETDRCIALIDTEAR
RLTKLVNENLDYEKIRSNKIKLQKTRFNGKEFLELIKEQLDYVSSEKGNTITVSIDKDMA
IYADYDRLTQVFINIVKNSVQFTENGQITLTGTQDYKESVLTITDTGIGMNTEELEQIWE
RFYKADMSRTNTAFGESGIGLSIVKQLIEYHDGSITVTSEPNKGTSFTIRLPFFQDNEQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaatgaaatttaaatatgcttaccaattatttttcacacaatttatcattttg
cttattgcttgtatcatgattggggtgcttgtctctcactccttaaaagattatttttac
caaagccaagtagatgacttaacaagttatgggcaaacgatttctagggatattcgctat
tcgccacaagatgcaacgatgcaagttttgaatacgtatcagcgaattttagatgtgaaa
aaaattcattatacaatcaaaaacgccaacgatgaaaccatttatccaacacagatgaat
cagccgttaccaaaggatttctctatttcttcggatgataagaaaaagcttgaaagtggc
gaaacagttagtaagaaaatagataatcgctttaataaagaaatgacaattgtgtacgtc
ccaataatgaatggcgacaaatttgtcggttctatcgtgctcaattcacctattagcggt
acggagcaagtaattggtacgattaaccgctatatgttctacactattttactttctata
acggtagcacttattcttagcgcaatcttgtccaaactacaagtaaatcgaatcaacaaa
ctacgagcagcgacaaaagacgttattcaaggcaattacaaagctcgattgaaggaaaat
aattttgatgaaattggtgcacttgccattgatttcaataaaatgacacaaacccttgaa
acatctcaagaagaaatagaacgacaagagaagcggagacgccagtttattgctgatgtt
tctcatgaaatgcgtaccccgctcacaacgattagtggcctcacggaaggtttagtaaat
gatattattccaaaaagtgaaacagatcgttgcatagcactcattgatacagaagctaga
cgtttaacgaaactagtcaatgaaaatttagattatgaaaaaatccgcagtaacaaaatt
aaacttcaaaaaacacgttttaatggtaaggaattccttgagttaatcaaagaacaactt
gattatgtatcaagcgaaaaaggtaacactattactgtttctatcgataaagacatggcg
atttacgcagattacgatcgtttaacacaagtatttatcaatatcgtcaaaaatagtgtc
caatttactgaaaatggtcagattactctaactggcacacaagattataaagaatctgtt
ttaacgataacagatactgggattggtatgaatacagaggaattagaacaaatttgggaa
aggttttataaagcagatatgtctcgaacaaataccgcttttggcgaatctggtattggc
ttatccattgtgaagcagttaattgaatatcacgatggatcaattacagtgactagtgaa
ccaaataaaggtacttcatttactattcgccttccttttttccaagataacgaacaataa

DBGET integrated database retrieval system