KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_1911Help
Entry
BN419_1911        CDS       T02513                                 

Definition
(GenBank) ADP-dependent (S)-NAD(P)H-hydrate dehydratase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN419_1911
Enzymes [BR:lmob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     BN419_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase
Motif
Other DBs
NCBI-ProteinID: CCQ24227
LinkDB All DBs
Position
1555610..1556440
Genome map
AA seq 276 aa AA seqDB search
MKKITPKAMCAWIPKREDETHKGDYGRVLIVAGNKQFGGAAIMAAEACVKSGAGLTTVAS
DSVNRPALQTRIPECMFIDYENITSLSEQISQFDTILIGPGLGLDAYAEEIFRLVLQKST
EHQQVIIDGDGITIYAKGENPHPAAKLTFTPHAGEWERLKVLAPDAVTPTDVALAIDATI
VLKGHRTKVYSGESAWQNMYGTPAMATGGMGDTLAGTICGLMAQTEKPITGTLAAVFLHS
YIGEILAKKRYVVLPTEIAEELPTYLKIFSETDEHA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataacaccaaaagcaatgtgcgcatggattccaaaacgtgaagacgaaaca
cataagggtgactatgggcgcgttctgattgtcgctggaaataaacaatttggcggtgct
gctattatggccgcagaagcttgtgtcaaaagtggggctggcttaacaaccgttgcttcc
gatagcgtcaaccgtcctgctctccaaacaagaatacctgaatgtatgtttattgattac
gaaaacatcacaagtctaagtgaacaaatcagccaatttgatacaatattaatcggccct
ggacttggacttgatgcctatgcggaagaaatttttcgtttagttttacaaaaatcaacc
gaacatcagcaagtaattattgatggtgacggcattactatctatgctaaaggagaaaat
cctcaccctgccgcaaaactaacctttacgccccatgcaggagaatgggaacgacttaaa
gtactagcaccagatgctgttacgccaactgatgtagcccttgctattgacgcaacaatc
gtacttaaaggtcatcgtacgaaagtgtattccggcgagtctgcttggcaaaatatgtat
ggcaccccagccatggccactggcggtatgggagatacgcttgcaggcacgatttgcgga
ttaatggcgcaaacagaaaagccgattactggcacactagctgcggtctttcttcacagc
tatatcggcgaaattttagcaaaaaaacgttatgtagtacttccaaccgaaatcgccgaa
gaattaccaacttacttgaaaatttttagcgaaactgacgaacatgcctaa

DBGET integrated database retrieval system