KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_2106Help
Entry
BN419_2106        CDS       T02513                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00970  Aminoacyl-tRNA biosynthesis
lmob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN419_2106
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmob03029]
    BN419_2106
Enzymes [BR:lmob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN419_2106
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN419_2106
Mitochondrial biogenesis [BR:lmob03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN419_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1
Motif
Other DBs
NCBI-ProteinID: CCQ24389
LinkDB All DBs
Position
complement(1705784..1707214)
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGM
KAAMAINCEIAEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHGWIEIEVGGKKKKIGITR
LHLEEDAGKNTHTSHGYSLVDINRQGTPLIEIVSEPDIRSAEEAYAYLEKLKSIIQYTGV
SDVKMEEGSMRCDANISIRPIGQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEVLKSGG
IIEQETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERIRAEIPELPDKR
QIRYINDLGLPAYDAMVLTLTKEMSDFFEATLVAGADAKQASNWLMGEVSAYLNAEQKEL
HETGLTPENLAGMIKLIEAGTISSKIAKKVFRELAQNGGDAEQVVKDKGLVQISDEGALR
TIISEILDNNEQSIVDFKNGKDRAVGFLVGQVMKATKGQANPPMVNKLLLEEMNKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagttattggacttgaggttcacgtagagttaaaaaccaattcaaaa
atattttcttctgcgccagctcattttggagcagaaccaaatacaaatacaaccgtggta
gacttaggtatgccaggtgttttaccagttttaaataaacgtgctgtagaattcggtatg
aaagcagcgatggcaatcaactgtgaaattgctgaacatacaaaattcgaccgcaaaaac
tatttctatccagataatcccaaagcatatcaaatttcccaatttgataaaccaatcggc
gaacatggctggattgaaatcgaagttggcggcaaaaagaaaaaaatcggcatcactcgt
cttcatttagaagaagatgctgggaaaaacacgcatacttctcatggttattcgttagta
gatattaaccgtcaaggaacgccactaatcgaaatcgtttctgaaccagacattcgttct
gcagaagaagcttatgcgtacctagaaaaattaaaatctattattcaatacactggcgta
tccgatgtgaaaatggaagaaggttcgatgcgctgtgatgccaatatctctatccgtcca
atcggccaagaagaatttggtgtgaaaacagaactaaaaaacctgaactcattcaacaat
gtgcgtaaaggtatcgaatatgaagaaaaacgccaagcagaagtgcttaagtctggcggc
attatcgaacaagaaactcgtcgttttgaagaagcaactggaaaaacttccttgatgcgt
atcaaagaaggttctgacgattatcgttatttcccagagccagatttagtagatttattt
attgatgacgcttggaaagaacgtattcgtgcagaaattcctgaacttccagataaacgt
caaattcgttacattaacgatcttggtttaccggcatatgacgcaatggttcttacgctt
acgaaagaaatgtctgacttttttgaagcaactcttgtagctggagcagatgcaaaacaa
gcatctaactggttaatgggcgaagtttctgcctacttaaacgcagaacaaaaagagctt
catgaaacaggactaactcctgaaaaccttgctggcatgattaaattaatcgaagccggt
actatttcctctaaaattgctaaaaaagttttccgcgaattagcgcaaaatggtggcgat
gcagagcaagtagtaaaagacaaaggacttgttcaaatttccgatgaaggagctttacgc
actatcatcagcgaaattctagataacaatgagcaatccattgtcgatttcaaaaatggt
aaggatcgtgctgttggattcttagttggccaagtaatgaaagcaaccaaagggcaagca
aatccgccaatggttaataaattattactagaagaaatgaacaaacgttaa

DBGET integrated database retrieval system