KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_2188Help
Entry
BN419_2188        CDS       T02513                                 

Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmob01001]
    BN419_2188
Enzymes [BR:lmob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BN419_2188
Protein kinases [BR:lmob01001]
 Serine/threonine kinases: Other
  Bacterial family
   BN419_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 YukC LPD29 DUF4448 ETRAMP
Motif
Other DBs
NCBI-ProteinID: CCQ24466
LinkDB All DBs
Position
complement(1775119..1777086)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSAREQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFPTDDGDTKAIPIIATKD
TMQNLDKTIVPEGKVAAAEVVPEEKKDKKKKKMSKKKKIALIVSSVIIIFIIGILLLWLL
GKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNSDEVDEGKVINTDPEAGEMKEK
GTKINLFVSIGSKKITMDDYTGRSYTDTKALLEEQGFKNISSEEAYSSEIEKGLIISQTP
TQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSKEENSSTVEK
GQVISQSPSAGTAMNSGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKIQIY
IQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSAGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaagcgattaagcgatcgatataagattttacatgcaataggcggcggc
ggaatggccaatgtgtacttggcgcatgatattattcttgatagagatgttgcagtgaaa
attttacgaatcgatttggcagatgaaagcaaccttattcgtcggttccaacgagaagct
caatcagcaacaagtctcgttcaccctaatattgttagtgtgtacgatgttggtgaagaa
aatgatttacactatattgtaatggaacatgtagatgggatggatttaaaacagtacatt
cacgaaaatcatccaatcagttatgaaaaagcagtagatattatgctgcaaatcgtttct
gcggtagcaatcgcccatcaacatcacattatccaccgtgacttaaaaccgcaaaatatt
ttaattgatcatgatggtgtcgtgaagattacagattttggtattgcaatggcactttca
gaaacatctattacacaaacgaattctttactaggttcggtgcattacttatccccagaa
caagcacgtggcggaatggcaacacaaaaatcagatatctattcacttggcattgtgtta
tacgaactattaactggaaaagtaccttttgacggggagtcagcagtttctatagctatt
aagcatctgcaagcagacatcccatccgcaagagaacaaaatccagaaattccacaaagc
ttagaaaatattattattaaagcaacggcgaaagatccatttttacgttaccaaaacgcg
gaagaaatggaaaaagacttgcaaacttgtttaaataaagaccgtttgaacgagccaaaa
tatgttttcccaacagatgatggtgatacaaaagcaattccaatcatcgcaacaaaagat
acgatgcaaaaccttgataaaacgattgttccagaaggaaaagtagccgctgccgaagta
gttcctgaggagaaaaaagataagaaaaagaaaaaaatgagcaagaaaaagaaaattgct
ctcattgtttcttctgtcattatcatttttatcatcggtattttactactgtggctttta
ggcaagagccctgatgaagtcgctgtgccggacgtttctggtaaaacggaagaccaagca
gtggcgttacttcaaaaagaaggctttgtcataggtaaaacagcagaaaaaaatagtgat
gaagtagatgaggggaaagtaattaataccgacccagaagctggagaaatgaaagaaaaa
ggaacaaaaatcaatttattcgtaagcattggttctaaaaaaataaccatggatgactat
acaggaagaagttacacagatacaaaagctttacttgaagaacagggatttaaaaatatt
tcttcggaggaagcttatagttcagaaattgaaaaaggcttaattattagccaaacaccg
acacaaggaacagaagtagtcgctaaatcaacagatgtgaaattcgtcgtaagtaaaggt
gcagagccaattacactgaaagatttacgaggttatactaaaacagcagtagaagattat
gcttcaccacttgggctaaaagtttcaagtaaagaagagaactcaagtacagtggaaaaa
ggacaagttatttcacagtccccatcagctggaacagcaatgaactctggtgatacaatc
gagattgtcatttctgctggaccaaaagaaaaacaagtaaaagaagtaactaaaacattt
aacatcccttatacaccaagtgatgaagaaaacccacaaccacagaaaattcaaatctac
attcaagataaagaccatagcatgactagcgcttaccgagaaatgagcattacacaaaat
acctcggtagaaataactttccaaattgaagaaggttctagcgcaggctacaaaatcatc
agtgatgataaagtaatcgatgaaggtacagtcccttatccaaattaa

DBGET integrated database retrieval system