KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_3159Help
Entry
BN419_3159        CDS       T02513                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00040  Pentose and glucuronate interconversions
lmob00051  Fructose and mannose metabolism
lmob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN419_3159
   00051 Fructose and mannose metabolism
    BN419_3159
Enzymes [BR:lmob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BN419_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCQ25356
LinkDB All DBs
Position
complement(2578216..2579247)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaatcccggatatgatcaaatggagctaaaagatgtggaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagatatccatacgtttaaaggagaatacaaaaatccaacaactcccgtcacacttgga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacgagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagagtgtatttattgtaaggaa
catgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgccacgtgctagatgaacgtatttcgctc
gaagcagcagcactgacagaaccacttgcatgttgcgtgcattcggcgcttgaaaaaaca
acgattcgtccagatgacacagtacttgttttcggaccggggccaattggattattacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagc
gaccgcttacgtctagcaaaagaacttggaatggaccggattgtcgataccttaaaagaa
gacttggctgaagttgtgctcggcatgacagggggttacggagcggaacgcgtatttgat
tgctcaggcgcagtaccagctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatctattatc
caacgtgaaattgcttatattggcagccgttctcaaaaaccatcttcttggattttagca
ctcgacttacttgctaatggcaaaatcgatacagataaaatgattaccaaagtatatggt
ttagatgactggcgcgaggctttcgaggcagttatggcaggtaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system