KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_0399Help
Entry
LMOSLCC5850_0399  CDS       T02223                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00330  Arginine and proline metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01130  Biosynthesis of antibiotics
lmoc01230  Biosynthesis of amino acids
Module
lmoc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LMOSLCC5850_0399 (proC)
Enzymes [BR:lmoc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LMOSLCC5850_0399 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA PDH Semialdhyde_dh DapB_N 2-Hacid_dh_C IlvN GFO_IDH_MocA NAD_binding_3 Rossmann-like 3HCDH_N CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CBY50868
LinkDB All DBs
Position
complement(416813..417613)
Genome map
AA seq 266 aa AA seqDB search
MNRIGFIGAGNMGTAMIRGLAQANLVKREEIIVGGRNLEKLKPLEAEFTGLQITTDTEKL
VEQADIIILAVKPYTIPEILTSVKEKLTPDKIIISVAAGVTIQDLEELTSAKTKIVRVMP
NTPALVGEAMSSVSPNTNVTSEELKEVTAIFTSFGEAEVVSENLMDAVIGVSGSSPAYVY
MFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHPGKLKDMVTSPGGTTIEAV
KSLENDGFRSAVINAVQAAAKKNSSM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatcggctttattggcgcaggaaatatgggaactgcaatgattcgaggttta
gcacaagcgaatttagtgaaaagagaagaaatcattgttggtggtcggaatctcgaaaaa
ttaaaaccacttgaagcggaatttactggcttacaaataacaaccgataccgagaaactc
gtagaacaagcagatattattattttagcggtgaaaccttatactataccagaaatttta
acgtcggtaaaagagaagcttacacctgataaaatcattatttctgtagcggctggcgta
actatccaagatttagaagaactcacttcagcaaaaacaaaaattgttcgagtgatgcca
aatacaccagcgcttgtcggcgaagcaatgtcatccgtttcaccaaatacgaatgtaaca
tccgaagaacttaaagaagtgacagctatttttactagctttggagaagcagaagtcgtt
tccgaaaatttgatggatgcggttattggcgtcagcggctcttcaccagcctatgtttat
atgttcatagaagctttagcagacggcgcagtgctaagtggcatgcctcgcgataaagca
tataaattcgccgcacaagctgtgctaggtgccgcaaaaacggttctggaaactggcgaa
catccaggtaaacttaaagatatggttacttctcccggcggaactacaattgaagcagtg
aaatcactagaaaatgatggtttccgttccgctgttatcaatgcagttcaagctgctgca
aagaaaaatagttcgatgtaa

DBGET integrated database retrieval system