KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_0974Help
Entry
LMOSLCC5850_0974  CDS       T02223                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00061  Fatty acid biosynthesis
lmoc00780  Biotin metabolism
lmoc01100  Metabolic pathways
lmoc01130  Biosynthesis of antibiotics
lmoc01212  Fatty acid metabolism
Module
lmoc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LMOSLCC5850_0974 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LMOSLCC5850_0974 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LMOSLCC5850_0974 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lmoc01004]
    LMOSLCC5850_0974 (fabI)
Enzymes [BR:lmoc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LMOSLCC5850_0974 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LMOSLCC5850_0974 (fabI)
Lipid biosynthesis proteins [BR:lmoc01004]
 Fatty acid synthase
  Component type
   LMOSLCC5850_0974 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CBY51443
LinkDB All DBs
Position
982826..983614
Genome map
AA seq 262 aa AA seqDB search
MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRAKKSITELVPSLSEVN
QNPLILACDVTSEEAITETFETIKDKAGKLSGLAHCIAFANKDFLTGDYLEVDRKSFLQA
HEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYNIMGVAKASLDASVRYLA
MDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPLKRATQAEEVGDTAYYLFS
NLSRGVTGEVIHVDSGYHIIGF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcattagagggaaaaacttatgttgtaatgggagtagctaataagcgtagt
attgcttgggcaattgcgcgttcactaaatgaagctggagcaaaactggtatttacatat
gcggacgatcgtgcgaaaaaaagcattacagagctagtaccttcattaagcgaagtaaat
caaaatccacttatcttagcttgtgatgtaacaagtgaagaagctattacagaaactttt
gaaacaattaaagataaagctggcaaacttagcggcctagcacactgcattgcttttgca
aacaaagactttttaactggggactatttagaagtagatcgtaaaagcttcttacaagca
catgaaattagtgcctattcattcacagctgttgctcgtgcactaaaacacttagaaatg
ttgacagaagatgcaagtttactaacattaacttaccttggtggggaacgtgtagtagaa
aactataatattatgggtgtagcaaaagcttctctggatgcaagtgttcgatacctcgca
atggacttaggggcaattggtgttcgtgtaaatgctatttctgcaggaccaatcagaaca
gtatctgctcgtggcgttagcggtttctctgattctatttcactagtggaagaaagagcc
ccactaaaacgtgcgacacaagcggaagaagttggcgacacagcatattacttattcagt
aatttatctcgaggcgttacaggcgaagtaattcatgtagatagcggttatcatattatt
ggattttaa

DBGET integrated database retrieval system