KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_1775Help
Entry
LMOSLCC5850_1775  CDS       T02223                                 

Definition
(GenBank) major facilitator family transporter
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Nuc_H_symport MFS_3 PUCC Tom22
Motif
Other DBs
NCBI-ProteinID: CBY52244
LinkDB All DBs
Position
1775182..1776441
Genome map
AA seq 419 aa AA seqDB search
MKFSTWDINLKVRLFGEALLDISFWMVFPFLTIYFSESIGRELTSLLLIISQVLAVFTAL
LGGYFADNFGRKRMMSISVIGEGFGFLVFAIGALHVVDSPYLSFAGFAIASVFMAFYQPA
SQAMIADVVPPEHRTHIYSVFYMMINIAVVIGPILGSVLFYNFTTETLLAIVCADLLLLF
LLQKFGHETAPLLVNPDLQKEAVRKSIGAVLMEQLKNYKIIFKDKIFFLYIVAGIIVSQS
FMQLDLLFPLYIKEVIGASNLFAFHFTGEQLFGVIVSINGFFVAALTVVVTRWMSHFREK
FVFMNSSFLYAIAIFLFGISTGPWGAICAIILFSFAELMTVGLQQTFVSQLAPEDKRAMY
FSAAGLRYTLGKVIAPLAITLSTLIGYTGTFTIIGILALISGLIYYYMYSEFEKQRQVS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtacatgggacatcaatttaaaagtaaggctttttggggaagcgctactc
gatatttctttttggatggtcttcccctttctaacgatttacttttcggaaagtattggg
cgcgaactgacgagccttctgctaattatctcgcaagtgttggcagtcttcacagctttg
cttggcggctattttgcagataactttggtcgtaaacggatgatgagtatttctgtcatc
ggagaaggctttggctttcttgtttttgcaataggtgcacttcatgttgtggattctcct
tacttaagttttgctggtttcgcgattgcgagtgtttttatggctttttatcagccagca
agtcaagcaatgattgccgatgtggttcctcctgagcatcggacgcatatttattcggtg
ttctatatgatgattaatattgcggtcgttattggtccaattcttggctcggttttattt
tataatttcacgacagaaacactacttgcaattgtttgcgcggatttattattactattt
ttactgcaaaaatttggtcacgaaacagcccctcttttagttaatcctgatttacaaaaa
gaagcggttcgaaaaagtattggtgctgttttaatggaacagctaaaaaactataagatt
atttttaaagacaagattttctttctttatattgttgccgggattattgtttctcagtcg
tttatgcaactggatttacttttcccgctctatattaaagaagttatcggtgcctctaac
ttgttcgcatttcattttacaggtgagcaattgttcggggttattgtttctattaatggc
ttctttgttgcagcgcttacggtcgttgtcactcgttggatgagccattttagagaaaaa
tttgtctttatgaattcttcttttctctatgcgattgcgattttcttatttggtatttcg
acaggaccgtggggagcgatttgtgccattattctctttagcttcgcggaactgatgact
gttgggttacaacaaacttttgtttcccagttagctccagaagataagcgcgctatgtac
ttttctgctgctggacttcgttacacgctgggtaaagtcattgctccacttgcgattaca
ctttcgactttaattggctatactggcacatttactattattggtattttagcgctcatt
agcgggctcatttattactatatgtattcagaatttgaaaaacagcggcaagtttcctaa

DBGET integrated database retrieval system