KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_2368Help
Entry
LMOSLCC5850_2368  CDS       T02223                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00250  Alanine, aspartate and glutamate metabolism
lmoc00410  beta-Alanine metabolism
lmoc00430  Taurine and hypotaurine metabolism
lmoc00650  Butanoate metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01120  Microbial metabolism in diverse environments
lmoc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC5850_2368 (gadG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC5850_2368 (gadG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC5850_2368 (gadG)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC5850_2368 (gadG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC5850_2368 (gadG)
Enzymes [BR:lmoc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC5850_2368 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CBY52837
LinkDB All DBs
Position
2392654..2394048
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKEHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIFNDGSHLPIVCYKLKDDANVNWTLYDLADRLQMRGWQVPAYPLPKSLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDNQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccactcgaacctcggattgct
taccgtttagtgaaagacgaacttttagatgaaggttccgcccgccaaaacctagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgaatacccaagaacagctgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaatttatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gccgaaaaacttggcctagatatttatgcaaaaaaaccaaatctcgttatctcctctggc
taccaagtgtgttgggaaaaattctgtgtttactgggatatcgatatgcgcgttgttcca
atggataaagagcacatgcaactcaataccgatcaagtccttgattacgtcgatgaatat
acaatcggtgtggtcggcatcctcggtatcacttacacaggccgctatgatgacatctac
gcgctaaatgaaaaacttgaagaatacaatagcaaaaccgattataaagtctacattcac
gtcgatgcagctagtggaggtttcttcactccatttgtcgaacctgacattatctgggac
ttccgtttgaaaaacgttatctcaattaatacttccggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcatcttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaactggc
tactttgacatttttaacgatggctcccacttaccaatcgtctgctataaattaaaagac
gacgccaatgtaaattggacattatacgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatatccactaccaaaaagcttggaaaacattattattcaacgttacgtc
tgccgcgctgaccttggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacatccttttccacgataatcaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system