KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_2665Help
Entry
LMOSLCC5850_2665  CDS       T02223                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lmoc03012]
    LMOSLCC5850_2665 (tufA)
   03029 Mitochondrial biogenesis [BR:lmoc03029]
    LMOSLCC5850_2665 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoc04147]
    LMOSLCC5850_2665 (tufA)
Translation factors [BR:lmoc03012]
 Eukaryotic Type
  Elongation factors
   LMOSLCC5850_2665 (tufA)
 Prokaryotic Type
   LMOSLCC5850_2665 (tufA)
Mitochondrial biogenesis [BR:lmoc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LMOSLCC5850_2665 (tufA)
Exosome [BR:lmoc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMOSLCC5850_2665 (tufA)
  Exosomal proteins of breast cancer cells
   LMOSLCC5850_2665 (tufA)
  Exosomal proteins of colorectal cancer cells
   LMOSLCC5850_2665 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBY53134
LinkDB All DBs
Position
complement(2692993..2694180)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGYADAQAYDQIDGAPEERERG
ITISTAHVEYQTDSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKCDMVDDEELLELVEMEIRDLLTEYEFPGDDIPVIKGSALKALQ
GEADWEAKIDELMEAVDSYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
DEVEVIGIEEESKKVVVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGSI
TPHTNFKAETYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNIEL
AVELIAPIAIEDGTKFSIREGGRTVGAGVVSNISK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgaccgctctaaaccccatgttaacattggtactattggacac
gttgaccatggtaaaacaactttaactgctgcaattacaactgtacttgctaaaaaaggc
tatgctgatgcacaagcttatgaccaaattgatggtgctccagaagaaagagaacgtgga
atcacaatctctactgctcacgttgagtaccaaactgacagccgtcactatgcacacgtt
gactgcccaggacatgccgattacgttaaaaacatgatcactggtgctgcacaaatggac
ggagctatcttagtagtatctgctgctgatggcccaatgccacaaactcgtgaacatatc
ttactttcacgtcaagttggtgttccatacatcgttgtattcatgaacaaatgtgacatg
gttgacgatgaagaattactagaattagttgaaatggaaattcgtgatctattaactgaa
tatgaattccctggcgatgacattcctgtaatcaaaggttcagctcttaaagcacttcaa
ggtgaagctgactgggaagctaaaattgacgagttaatggaagctgtagattcttacatt
ccaactccagaacgtgatactgacaaaccattcatgatgccagttgaggatgtattctca
atcactggtcgtggaacagttgcaactggacgtgttgaacgtggacaagttaaagttggt
gacgaagtagaagttatcggtatcgaagaagaaagcaaaaaagtagtagtaactggagta
gaaatgttccgtaaattactagactacgctgaagctggcgacaacattggcgcacttcta
cgtggtgttgctcgtgaagatatccaacgtggtcaagtattagctaaaccaggttcgatt
actccacacactaacttcaaagctgaaacttatgttttaactaaagaagaaggtggacgt
cacactccattcttcaacaactaccgcccacaattctatttccgtactactgacgtaact
ggtattgttacacttccagaaggtactgaaatggtaatgcctggtgataacattgagctt
gcagttgaactaattgcaccaatcgctatcgaagacggtactaaattctctatccgtgaa
ggcggacgtacagtaggcgctggcgttgtttctaacatcagcaaataa

DBGET integrated database retrieval system