KEGG   Listeria monocytogenes EGD (serotype 1/2a): LMON_1420Help
Entry
LMON_1420         CDS       T02872                                 

Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lmod  Listeria monocytogenes EGD (serotype 1/2a)
Pathway
lmod00061  Fatty acid biosynthesis
lmod00620  Pyruvate metabolism
lmod00640  Propanoate metabolism
lmod01100  Metabolic pathways
lmod01110  Biosynthesis of secondary metabolites
lmod01120  Microbial metabolism in diverse environments
lmod01130  Biosynthesis of antibiotics
lmod01200  Carbon metabolism
lmod01212  Fatty acid metabolism
Module
lmod_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lmod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMON_1420
   00640 Propanoate metabolism
    LMON_1420
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LMON_1420
Enzymes [BR:lmod01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LMON_1420
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LMON_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK GARS_A ATPgrasp_Ter Oxidored_nitro ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CDG45277
UniProt: A0A3Q0NE99
LinkDB All DBs
Position
1383707..1385071
Genome map
AA seq 454 aa AA seqDB search
MIKKVLVANRGEIAVRIIRAAKELGVETVAIYSEADREALHIQLADEAYCVGPAATKDSY
LNMSNIISLAVLTNCDAIHPGYGFLAENADFAELCEDCNITFIGPSASAISQMGTKDVAR
ETMRKAGVPIVPGSQGIVADVEDGKKIAKKIGYPVIIKATAGGGGKGIRVAENEEKLISG
IHTTQQEAEAAFGDPGVYLEKYIQDFRHVEIQVLADNHGNVIHLGERDCSIQRRLQKLIE
ESPSPAIDEKTRQKMGKAAVKAAKAVNYSGAGTIEFIYDHHENNFYFMEMNTRIQVEHPV
TELVTGIDLVKQQFLVASGEELQIKQADVKLTGWAMECRINAENPEKNFMPAPGEIKFYL
PPGGLGVRIDSAAYPNYKIPPYYDSMIAKVICYAETREEVIQKMKRALSEFAIDGIPSTI
PFHLRVLDNDVFLSGDFNTKFLEQNDVMNLSKEG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagtactggtagcgaaccgtggagaaatcgctgtccgtatcattcgcgct
gcaaaagaacttggagtggagacagtggcgatttattcggaagcagatagagaagcgcta
catattcagctggcggatgaagcttattgtgtaggtcccgcggcaacaaaagatagttat
ttaaatatgtcaaacattattagccttgctgttttaacgaactgtgatgctattcatcct
ggctatggtttcttagccgaaaatgcagatttcgctgagttatgcgaagactgcaatatt
acttttatcgggccaagcgcttccgctatttcgcaaatgggaacaaaagatgttgcccgt
gaaactatgcgtaaagcaggtgttccaatcgttcctggttcacaaggaatcgttgccgat
gtggaagatggtaaaaaaatcgccaaaaaaatcggttatccggtgatcattaaagcaaca
gctggcggtggcggtaagggtattcgtgtagcagaaaatgaagaaaaattaatctctggt
attcatacgacgcaacaagaagcagaagcagcatttggagatccaggcgtttatcttgaa
aaatacattcaagatttccgccacgtagaaattcaagtacttgctgataaccatggtaac
gtgattcatttaggagagcgtgattgtagtattcaacgtcgcttgcaaaagctaattgaa
gaatcaccatcacctgccattgatgaaaaaacacgccaaaaaatgggtaaagcggccgtt
aaagctgccaaagccgtgaattattctggtgcaggtacaattgaatttatttatgatcat
catgaaaataatttctactttatggaaatgaatactcgtatccaagtagaacaccctgta
acggaacttgttaccggaattgatttagtcaaacaacaatttttagttgcttcaggtgaa
gagctacaaattaaacaagcagatgtgaaattaacaggttgggcaatggagtgtcgtatt
aacgctgaaaatccggagaaaaactttatgccagctccaggagaaattaaattttatctt
cctccaggtggcttaggcgttcgaattgactcggcagcatatccaaactacaaaattccg
ccatattatgattcgatgattgctaaagtaatctgttatgcagaaacacgtgaagaagtt
attcaaaaaatgaaacgagcgttgtctgaatttgccattgatggcattccttcaaccatt
ccattccatttacgcgtgttagataatgatgtatttttatcaggcgacttcaatacaaaa
ttcttggagcaaaatgatgtaatgaatctttctaaggagggctaa

DBGET integrated database retrieval system