KEGG   Listeria monocytogenes EGD (serotype 1/2a): LMON_1502Help
Entry
LMON_1502         CDS       T02872                                 

Gene name
sod
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmod  Listeria monocytogenes EGD (serotype 1/2a)
Brite
Enzymes [BR:lmod01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LMON_1502 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDG45358
LinkDB All DBs
Position
complement(1475485..1476093)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaaccatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgcggaagaattagttactaac
ctagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcgggcatgct
aaccatacattgttctggtctattcttagcccaaatggtggcggcgctccaactggcaat
ttaaaagcagcaatcgaaagcgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagcagctgcagcacgttttggttctggttgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccattaagcgatggcaaaacacccgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaaccgtcgtcctgaa
tatatcgacacattttggaatgttattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system