KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_3135Help
Entry
BN418_3135        CDS       T02512                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lmoe03012]
    BN418_3135
   03029 Mitochondrial biogenesis [BR:lmoe03029]
    BN418_3135
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoe04147]
    BN418_3135
Translation factors [BR:lmoe03012]
 Eukaryotic Type
  Elongation factors
   BN418_3135
 Prokaryotic Type
   BN418_3135
Mitochondrial biogenesis [BR:lmoe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN418_3135
Exosome [BR:lmoe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN418_3135
  Exosomal proteins of breast cancer cells
   BN418_3135
  Exosomal proteins of colorectal cancer cells
   BN418_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCQ22202
UniProt: L8DYA0
LinkDB All DBs
Position
complement(2567250..2568437)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGYADAQAYDQIDGAPEERERG
ITISTAHVEYQTDSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKCDMVDDEELLELVEMEIRDLLTEYEFPGDDIPVIKGSALKALQ
GEADWEAKIDELMEAVDSYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
DEVEVIGIEEESKKVVVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGSI
TPHTNFKAETYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNIEL
AVELIAPIAIEDGTKFSIREGGRTVGAGVVSNISK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgaccgctctaaaccccatgttaacattggtactattggacac
gttgaccatggtaaaacaactttaactgctgcaattacaactgtacttgctaaaaaaggc
tatgctgatgcacaagcttatgaccaaattgatggtgctccagaagaaagagaacgtgga
atcacaatctctactgctcacgttgagtaccaaactgacagccgtcactatgcacacgtt
gactgcccaggacatgccgattacgttaaaaacatgatcactggtgctgcacaaatggac
ggagctatcttagtagtatctgctgctgatggcccaatgccacaaactcgtgaacatatc
ttactttcacgtcaagttggtgttccatacatcgttgtattcatgaacaaatgtgacatg
gttgacgatgaagaattactagaattagttgaaatggaaattcgtgatctattaactgaa
tatgaattccctggcgatgacattcctgtaatcaaaggttcagctcttaaagcacttcaa
ggtgaagctgactgggaagctaaaattgacgagttaatggaagctgtagattcttacatt
ccaactccagaacgtgatactgacaaaccattcatgatgccagttgaggatgtattctca
atcactggtcgtggaacagttgcaactggacgtgttgaacgtggacaagttaaagttggt
gacgaagtagaagttatcggtatcgaagaagaaagcaaaaaagtagtagtaactggagta
gaaatgttccgtaaattactagactacgctgaagctggcgacaacattggcgcacttcta
cgtggtgttgctcgtgaagatatccaacgtggtcaagtattagctaaaccaggttcgatt
actccacacactaacttcaaagctgaaacttatgttttaactaaagaagaaggtggacgt
cacactccattcttcaacaactaccgcccacaattctatttccgtactactgacgtaact
ggtattgttacacttccagaaggtactgaaatggtaatgcctggtgataacattgagctt
gcagttgaactaattgcaccaatcgctatcgaagacggtactaaattctctatccgtgaa
ggcggacgtacagtaggcgctggcgttgtttctaacatcagcaaataa

DBGET integrated database retrieval system