KEGG   Listeria monocytogenes serotype 4b LL195: BN389_00540
Entry
BN389_00540       CDS       T02416                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN389_00540 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmog03011]
    BN389_00540 (rpsF)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_00540 (rpsF)
Ribosome [BR:lmog03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BN389_00540 (rpsF)
  Bacteria
    BN389_00540 (rpsF)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_00540 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 AbiJ_NTD3 NAS
Other DBs
NCBI-ProteinID: CCO62628
UniProt: A0A0E1R309
LinkDB
Position
55767..56060
AA seq 97 aa
MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGF
YHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctagaaagtacgaaattatgtacatcattcgcccaaacattgaagaagatgagaaa
aaagctgttgtagaacgctttgacggaatcttaactgaaaatggtgcggagatcatcgaa
tcaaaagaatggggtaaacgtcgcttagcatacgaaatcaatgactatcgtgatggtttt
taccacatcgtgaaattaaacgctgataaagcagattctatcaacgaatttgaccgttta
gctaaaatttctgatgatatcattcgtcatatggtaattaaagaagaagcataa

DBGET integrated database retrieval system