KEGG   Listeria monocytogenes serotype 4b LL195: BN389_05250
Entry
BN389_05250       CDS       T02416                                 

Gene name
rpmF
Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN389_05250 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmog03011]
    BN389_05250 (rpmF)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_05250 (rpmF)
Ribosome [BR:lmog03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN389_05250 (rpmF)
  Bacteria
    BN389_05250 (rpmF)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_05250 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: CCO63099
UniProt: A0A0E1R3K7
LinkDB
Position
531407..531577
AA seq 56 aa
MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPDGTYKGRTIIEK
NT seq 171 nt   +upstreamnt  +downstreamnt
atggcagttccagctagacgtacgtccaaagcgaagaaaaacaagcgccgtacgcataaa
ggcttaacaacaccaggtttgagccgcgatagtgaaacaggcgaataccgtatgtcacac
cgcatctcaccagacggcacttataaaggtcgcacaattatcgaaaaataa

DBGET integrated database retrieval system