KEGG   Listeria monocytogenes serotype 4b LL195: BN389_17830
Entry
BN389_17830       CDS       T02416                                 

Gene name
gatC
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00970  Aminoacyl-tRNA biosynthesis
lmog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN389_17830 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_17830 (gatC)
Enzymes [BR:lmog01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN389_17830 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN389_17830 (gatC)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_17830 (gatC)
SSDB
Motif
Pfam: Glu-tRNAGln DUF1152
Other DBs
NCBI-ProteinID: CCO64357
UniProt: A0A0E1R6M4
LinkDB
Position
complement(1806083..1806379)
AA seq 98 aa
MLSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDV
SNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ
NT seq 297 nt   +upstreamnt  +downstreamnt
attttgtcaaatatatcaaaagaaacagtagaaaaagtagcaaatcttgccaaactagaa
gtatcagaaacagaagcaacagccttcgctggtcagcttggtaaaattattgagctagta
gagcaattaaatacgttagatacaacgaatgtagaacctaccagccatgcaatcgacgta
tcaaacgtattacgtgaagatgtggcaacaaaagggttggatcgcaaagaagtactaaaa
aatgcgcctgatgaacaagatggcatgttcaaagtaccgacaattatggaacaataa

DBGET integrated database retrieval system