KEGG   Listeria monocytogenes serotype 4b LL195: BN389_18240
Entry
BN389_18240       CDS       T02416                                 

Gene name
rpsP
Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN389_18240 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmog03011]
    BN389_18240 (rpsP)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_18240 (rpsP)
Ribosome [BR:lmog03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BN389_18240 (rpsP)
  Bacteria
    BN389_18240 (rpsP)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_18240 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: CCO64398
UniProt: A0A0E1R7X8
LinkDB
Position
complement(1847104..1847376)
AA seq 90 aa
MAVKIRLKRIGSKKKPFYRIVVADSRFPRDGRSIETIGTYNPLLDPVEVKIDEEATLKWM
HNGAKPSDTVRNLLSREGIMEKFHNQKLGK
NT seq 273 nt   +upstreamnt  +downstreamnt
atggcagttaaaattcgtttaaaacgtattggttctaaaaagaaacctttctaccgtatt
gtagtcgctgattctcgtttcccacgtgatggccgttcaatcgaaactattggtacttat
aatccattacttgatccggttgaagtgaaaatcgacgaagaagcaactttgaaatggatg
cataatggtgcgaaaccatctgatacagttcgcaatcttcttagccgcgaaggtatcatg
gaaaaattccataaccaaaaattaggtaaataa

DBGET integrated database retrieval system