KEGG   Listeria monocytogenes serotype 4b LL195: BN389_20750
Entry
BN389_20750       CDS       T02416                                 

Gene name
rpmF2
Definition
(GenBank) 50S ribosomal protein L32-2
  KO
K02911  large subunit ribosomal protein L32
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN389_20750 (rpmF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmog03011]
    BN389_20750 (rpmF2)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_20750 (rpmF2)
Ribosome [BR:lmog03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN389_20750 (rpmF2)
  Bacteria
    BN389_20750 (rpmF2)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_20750 (rpmF2)
SSDB
Motif
Pfam: Ribosomal_L32p Nop10p zf-ribbon_3 HypA DZR DUF1610 DUF1272 PolC_DP2 NRDD zf_UBZ
Other DBs
NCBI-ProteinID: CCO64649
UniProt: A0A0E1R7Z3
LinkDB
Position
complement(2118378..2118551)
AA seq 57 aa
MAVPFRRTSKAKKRKRRTHVKLQLPGMNECSNCGEYRLSHHVCPECGQYDGKDVANS
NT seq 174 nt   +upstreamnt  +downstreamnt
atggcagtaccttttagaagaacttcaaaagccaaaaagcgtaagcgtcgtacacacgtt
aaacttcaacttccgggcatgaacgaatgctcgaattgcggcgaatacagactttcccat
cacgtatgcccagaatgtggacaatatgatggcaaagatgtagcaaacagctaa

DBGET integrated database retrieval system