KEGG   Listeria monocytogenes serotype 4b LL195: BN389_23290Help
Entry
BN389_23290       CDS       T02416                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00250  Alanine, aspartate and glutamate metabolism
lmog00410  beta-Alanine metabolism
lmog00430  Taurine and hypotaurine metabolism
lmog00650  Butanoate metabolism
lmog01100  Metabolic pathways
lmog01110  Biosynthesis of secondary metabolites
lmog01120  Microbial metabolism in diverse environments
lmog02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN389_23290 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN389_23290 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN389_23290 (gadB)
   00430 Taurine and hypotaurine metabolism
    BN389_23290 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN389_23290 (gadB)
Enzymes [BR:lmog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BN389_23290 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CCO64903
UniProt: A0A0E1R9C8
LinkDB All DBs
Position
2386173..2387567
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKNQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactagaacctcggattgcc
tatcgtttagtgaaagacgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgagtacccaagaacagctgaactagaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaagaaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgctgggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcctctggc
taccaagtgtgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagatcacatgcaactgaataccgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctac
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatattatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
cctggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaacttattttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcatcaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgcgctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgctcacatcctcttccatgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system