KEGG   Luteipulveratus mongoliensis: VV02_09875Help
Entry
VV02_09875        CDS       T04024                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00020  Citrate cycle (TCA cycle)
lmoi00480  Glutathione metabolism
lmoi01100  Metabolic pathways
lmoi01110  Biosynthesis of secondary metabolites
lmoi01120  Microbial metabolism in diverse environments
lmoi01130  Biosynthesis of antibiotics
lmoi01200  Carbon metabolism
lmoi01210  2-Oxocarboxylic acid metabolism
lmoi01230  Biosynthesis of amino acids
Module
lmoi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lmoi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VV02_09875
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VV02_09875
Enzymes [BR:lmoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VV02_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKU16097
UniProt: A0A0K1JHA1
LinkDB All DBs
Position
2048717..2049934
Genome map
AA seq 405 aa AA seqDB search
MEKIKVKNPIVELDGDEMTRIIWQFIKDRLIHPYLDVDLKYFDLGIESRDATDDQVTIDA
ANAIKEFGVGVKCATITPDEARVEEFGLKEMWKSPNGTIRNILGGVIFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKSQNFKVPGPGTVTITYTPADGSGEQSYEVAQFGEDGGVAM
AMYNFNKSIEDFARASLNYGLQRKVPVYMSTKNTILKAYDGAFKDIFQSVFDKEFKPQFD
ALGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTQGLAHRGKLDGTPEVTKFAETLE
RVCIQTVEEGKMTKDLALLISKEQPFLTTEEFLAALDENLQKAMA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatcaaggtcaagaaccccatcgtcgagctcgacggtgacgagatgacgagg
atcatctggcagttcatcaaggaccgcctgatccacccgtaccttgacgtcgacctgaag
tacttcgacctggggatcgagagccgcgacgccaccgacgaccaggtgacgatcgacgcc
gccaacgccatcaaggagttcggcgtcggcgtgaagtgcgcgacgatcacccccgacgag
gcccgcgtcgaggagttcggcctcaaggagatgtggaagagcccgaacggcacgatccgc
aacatcctgggcggcgtgatcttccgcgagccgatcatcatcagcaacatcccgcggctg
gtgccgggctggaccaagccgatcatcatcggccgtcacgcccacggtgaccagtacaag
tcgcagaacttcaaggtccccggaccgggcaccgtcaccatcacctacacgccggccgat
ggcagcggcgagcagtcgtacgaggtcgctcagttcggtgaggacggcggcgtcgcgatg
gcgatgtacaacttcaacaagtcgatcgaggacttcgcgcgcgcgtcgctcaactacggc
ctgcagcgcaaggtgccggtctacatgtcgaccaagaacaccattctcaaggcgtacgac
ggcgccttcaaggacatcttccagtcggtgttcgacaaggagttcaagccgcagttcgat
gcgctcggcctgacctatgagcaccgcctgatcgatgacatggtcgcctccgcgatgaag
tgggagggcggttacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacgtcggtgctgatgagccctgacggc
aagaccgtcgaggccgaggcggcgcacggcacggtgacccgtcactaccgccagcaccag
cagggcaagcccacgtcgaccaacccgatcgcctcgatcttcgcgtggacccagggcctg
gcgcaccgcggcaagctggacggcacgcccgaggtgaccaagttcgccgagaccctcgag
cgcgtctgcatccagacggtcgaggagggcaagatgaccaaggacctggccctcctgatc
agcaaggagcagcctttcctcacgaccgaggagttcctcgctgccctggacgagaacctc
cagaaggccatggcctga

DBGET integrated database retrieval system