KEGG   Luteipulveratus mongoliensis: VV02_11270Help
Entry
VV02_11270        CDS       T04024                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00250  Alanine, aspartate and glutamate metabolism
lmoi00410  beta-Alanine metabolism
lmoi00640  Propanoate metabolism
lmoi00650  Butanoate metabolism
lmoi01100  Metabolic pathways
lmoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VV02_11270
   00650 Butanoate metabolism
    VV02_11270
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV02_11270
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV02_11270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoi01007]
    VV02_11270
Enzymes [BR:lmoi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     VV02_11270
Amino acid related enzymes [BR:lmoi01007]
 Aminotransferase (transaminase)
  Class III
   VV02_11270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKU16308
UniProt: A0A0K1JIA1
LinkDB All DBs
Position
complement(2344404..2345654)
Genome map
AA seq 416 aa AA seqDB search
MAQLSPVLKQATPVVATHGEGVNLYDADGRRYLDFTAGIGVTSTGHCHPKVVAAAQEQVG
KLIHGQYTTVMHQPLLTLVDRLSEVLPQGLDRAFFANSGSEAIEAALRLARQATGRSNVI
VFHGGFHGRTVAAASMTSSGTKFRSGFSPLMAGVQVSPFPDPGHFGWSQEETTAFALKQL
DYTLQTLSAPNDTAAFFVEPVLGEGGYVPASTEFLAGLRERADKHGILLVLDEVQTGWGR
TGKFWGGDHFDAKADILVTAKGLASGFPLSAIAASNALMEKAWPGSQGGTYGANAVACAA
AIATLDVIQEEKLVENSAARGAQLKEGLQQVADKHDEIVDVRGLGLMIGNEFRDADGNPD
GSTAAKAQQEAAKRGLLLLTCGAWSQVVRFIPALVVSEQEVDEAAGLWAETIDAVL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtcaccggtgctcaagcaggcgacccccgtggtcgccactcatggcgag
ggcgtcaacctttacgacgcagacggtcggcgatacctcgacttcacggccgggatcggc
gtcacgagcaccgggcactgccacccgaaggtcgtcgccgctgctcaggagcaggtcggc
aagctgatccacgggcagtacacgacggtgatgcaccagcccctgctcaccttggtcgac
cgcctcagcgaggtgctcccccagggccttgaccgcgcgttcttcgccaactccggctcc
gaggcgatcgaggccgcgctccgcctggctcgtcaggcgaccggccgatccaacgtgatc
gtcttccacggaggcttccacggtcgtacggtcgcggcggcgtccatgacgtcgtccggc
acgaagttccgcagcgggttctcgccactgatggccggcgtccaggtgtcgccgttcccc
gaccccggccacttcggctggagccaggaggagaccaccgccttcgcgctgaagcagctg
gactacacgctgcagacgctgtcggcgcccaacgacaccgcggcgttcttcgtcgagccg
gtgctcggcgagggcggctacgtgcccgccagcaccgagttcctcgccggcctgcgcgag
cgcgcggacaagcacggcatcctgctcgtgctcgacgaggtccagaccggctggggtcgc
accgggaagttctggggcggcgaccacttcgacgccaaggccgacatcctcgtcacggcc
aaggggcttgcctccggcttcccgctgtccgcgatcgcagcctccaacgcactcatggag
aaggcctggcccggctcgcagggcggcacctacggcgccaacgcggtcgcgtgcgccgct
gccatcgcgaccctggacgtcatccaggaagagaagctcgtcgagaactccgccgctcgc
ggcgcccagctcaaggaaggcctccagcaggtcgccgacaagcacgacgagatcgtcgac
gtacgcggtctcgggctgatgatcggcaacgagttccgcgacgccgacggcaaccccgac
ggatccacagccgcgaaggcccagcaggaggccgccaagcgtggcctcctgctgctcacc
tgcggcgcgtggagccaggtcgtccgattcatcccggcgctggtcgtctccgagcaggag
gtcgacgaggccgccggcctgtgggccgagacgatcgacgccgtcctctga

DBGET integrated database retrieval system