KEGG   Luteipulveratus mongoliensis: VV02_16855Help
Entry
VV02_16855        CDS       T04024                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmoi  Luteipulveratus mongoliensis
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmoi01001]
    VV02_16855
Enzymes [BR:lmoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     VV02_16855
Protein kinases [BR:lmoi01001]
 Serine/threonine kinases: Other
  Bacterial family
   VV02_16855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Haspin_kinase RIO1 Kdo Kinase-like
Motif
Other DBs
NCBI-ProteinID: AKU17135
UniProt: A0A0K1JKM6
LinkDB All DBs
Position
3534947..3536956
Genome map
AA seq 669 aa AA seqDB search
MSKVASTSLVGRVIDGRYRVQSHLADGGMGTVFIAMDERLDREVALKVMRPDLARDDAFV
ARFRREARSAARLSHPHVVSVFDQGQDDSYVFLAMELVRGRTLRDVIRAEAPLTTRAALD
IFEAILQALAAAHQAGLIHRDVKPENVLISEDGRIKVADFGLARAVTTDTLTTNSDVLLG
TAAYLAPEQVEHGAVDQRSDVYSAGLLLFEMLTGEKAYPGDSPIHVAYQHVHGAVPMPSD
AVPGIAPELDALIALGSAKAPEDRPADAGAMLVEVRRARGALGQDQLDGRPQPGANGSAA
TGSSTMALSGDSTSQLRRPPPPQQHRAGQVGPGGPTGGPPGGQPPGGPLQGPAKPPHSGP
PAGARRAVATAPDERRTGWWIAAAVAVLLAVCGGGAAWWFTAGPGGTVTVPNVAGQGRGV
AVRTIDDAGLSVQVREVFNESVGRNTVVRTIPGGGADQRKSDAVVVEVSKGPERFIVPQV
VNVDQQAAQTRITQAHLKVAGVTEAFDETVPAGRVVSADPTVGSQLKKDAAVRLVVSKGR
QPITVPVVTGKPQAEAESAVTGAGLKVTLAPQAFDDTIPAGSVISQTPANGTLFKGQEVT
LVISKGPEMVTVPRVIDMNAKDARRTLEDAGLKVKVSRVFGGIFDTVRDQDPQPGTSTPK
GTEVKISVV
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaggtcgcttctacctccctcgtcggtcgcgtgatcgacgggcgataccgcgtt
cagtcccacctcgctgatgggggtatgggcaccgtcttcatcgccatggacgagcggctc
gaccgcgaggtcgccctcaaggtcatgcgcccggacctcgcgcgggacgacgcgttcgtc
gcgcgcttccgccgtgaggcccgatcggcggctcggctgtcccacccgcacgtggtcagc
gtcttcgaccagggccaggacgactcgtacgtcttcctcgcgatggagctcgtgcgcggc
cggacgctgcgcgacgtcatccgcgccgaggcacccctgaccacgcgcgccgcgctggac
atcttcgaggcgatcctccaggcgctggcagccgctcaccaggccggcctgatccaccgc
gacgtcaagcccgagaacgttctcatcagcgaggacggccgcatcaaggtcgccgacttc
ggtctggcgcgcgccgtcacgacggacacgctcaccaccaacagtgatgtgctcctgggc
acagccgcctacctcgcgcctgagcaggtcgagcacggtgctgtcgatcagcgcagcgac
gtctactcggccgggctgctgctgttcgagatgctgaccggcgagaaggcctatcccggc
gacagcccgatccacgtggcctaccagcacgtccacggggccgtccccatgccgtcggac
gcggtgccaggcatcgcgcccgagctggacgccctgatcgctctcgggtcggcgaaggct
cccgaggaccgaccggccgacgcgggcgcgatgctcgtcgaggtgcgtcgggcgcgcggc
gcgctcgggcaggaccagctggacggtcgtccccagcccggtgcgaatggcagcgccgca
accggcagctccacgatggcgctgagcggcgactccaccagccagctccgccggcccccg
cctccccagcagcaccgagcagggcaggtcggcccaggtgggccgaccggtggaccgcct
ggtggtcagccgcccggaggcccactgcaagggcccgcgaagcccccgcactccggtccg
ccggcaggcgcacggcgcgctgtcgccaccgcacccgacgaacggcgtacaggctggtgg
atcgcggcggccgtcgcggtgctgctggcggtctgcggcggaggcgccgcctggtggttc
accgccggacctggcggcacggtgaccgtgcccaacgtggccggtcagggccgaggtgtg
gcggtgcgcaccatcgacgacgcaggactgtcggtgcaggtgcgcgaggtcttcaacgag
agcgtcggtcgcaacacggtcgtccgtacgatcccgggcggcggagccgaccagcgcaag
tccgacgcggtcgtcgtcgaggtgtccaagggacccgagcggttcatcgtgccgcaggtc
gtcaacgtcgaccagcaggcggcgcagaccaggatcacgcaggcgcatctcaaggtggcc
ggcgtgaccgaggcgttcgacgagaccgtcccggccgggcgcgtcgtcagcgccgacccg
accgtcggcagccagctcaagaaggacgccgcggtgcgtctggtggtcagcaagggccgt
cagccgatcaccgtgccggtggtgacgggcaagccccaggctgaggccgagtccgccgtg
accggcgccggcctcaaggtcacgctcgcgccgcaggcgttcgacgacacgatcccggcc
ggctcggtgatcagccagacgccggccaacggcacgctcttcaagggtcaagaggtcacg
ctggtgatctccaagggaccggagatggtgaccgtgccgcgcgtcatcgacatgaacgcc
aaagacgctcggcgcaccctcgaggacgccggtctgaaggtgaaggtctcgcgagtcttc
ggcggcatcttcgacaccgtgcgcgatcaggatccgcagccgggcacgagcactccgaag
ggcaccgaggtcaagatctccgtggtctga

DBGET integrated database retrieval system