KEGG   Luteipulveratus mongoliensis: VV02_24655Help
Entry
VV02_24655        CDS       T04024                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00564  Glycerophospholipid metabolism
lmoi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VV02_24655
Enzymes [BR:lmoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VV02_24655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKU18288
UniProt: A0A0K1JNX7
LinkDB All DBs
Position
5153682..5155409
Genome map
AA seq 575 aa AA seqDB search
MVMQPFSAKLGPDERAQAWKELTEREFDVLVIGGGVTGAGTALDAATRGLRTGLVEARDF
ASGTSSRSSKLFHGGLRYLEQLNFSLVAEALKERELMLTTIAPHLVHPVPFLYPLSHRGW
ERPYVAAGLTMYDQMGGARSVPRQKHLTRGGALKLFPGLKSGVLVGAVRYYDAQADDARH
TMTVARTAAHYGAVVRTSTEVVEIIKEADRVTGVVVRDVETDERATVKAKVVINATGVWT
DDVQKMAGGRGRFRVRASKGVHILVARDRIAGEVGLILRTEKSVLFVIPWFQHWIIGTTD
TDWTHDLAHPAATATDIEYILEHVNSVMSVPITREDIVGVYAGLRPLLAGESEDTSQLSR
EHAVARPAPGLISIAGGKYTTYRVMAEDAVNAAAKDLGALKDSVTEHVPLVGADGYAAMV
NLKHELAAETGLPEWRIEHLLGRYGSQLHEVLALSEDDPSLLEPVKDAEQYLRAELKYAV
THEGALHLADVLARRTRMSIETKHRGVGAAEEAAAIMAPVLKWSKAKVKDEITAYAERVK
AERASQELDTDEASDAARGEAPETRPGLRDVTATT
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgcagcccttcagcgccaagctgggccccgatgagcgcgcccaagcgtggaag
gagctgaccgagcgcgagttcgacgtgctggtcatcggtggcggggtgaccggggccggc
acggcgctggacgccgcaacccgagggctacgaacgggactcgtcgaggcgcgcgacttc
gccagtggcacgtcgtcgcgctcgagcaagctcttccacggtggcctgcgctacctcgaa
cagctcaacttctcgctcgtcgcggaggcgctcaaggagcgcgagctgatgttgaccacg
atcgcgccccacctcgtacaccctgtgccgttcctctacccgctgtcgcatcgcgggtgg
gagcgtccgtacgtcgccgccgggctgaccatgtacgaccagatgggcggcgctcgctcg
gtcccccgccagaagcacctcactcggggcggcgctctcaagctgttccccggcctgaag
tccggtgtgctcgtcggcgcggtccgttactacgacgcgcaggccgacgacgcccgccac
acgatgaccgtggcgcgcaccgccgctcactacggcgccgtcgtccgcacctcgaccgag
gtcgtggagatcatcaaggaagccgaccgggtcacgggcgtcgtggtgcgcgacgtcgag
accgacgagcgggcgaccgtgaaggccaaggtggtcatcaacgcgaccggcgtctggacc
gacgacgtccagaagatggccggcggccgaggccgcttccgcgtgcgggcgagcaagggc
gtacacatcctggtggcgcgggaccggatcgccggcgaggtcgggctgatcctgcgcacg
gagaagtccgtgctgttcgtgatcccgtggttccagcactggatcatcgggacgacggac
accgactggacccacgacctggcgcaccccgccgcgacggccaccgacatcgagtacatc
ctcgagcacgtcaacagcgtgatgtcggtgccgatcacccgcgaagacatcgtcggtgtc
tacgccggtctgcggcccctgctcgcgggcgagagcgaggacaccagccagctgtcccgt
gagcacgcggtcgcccggcccgctccggggctgatctcgatcgcgggcggcaagtacacg
acgtaccgcgtgatggcggaggacgcagtcaacgcagccgcgaaagaccttggtgcgctg
aaggattcggtgaccgagcacgtaccgctggttggtgctgacggctacgccgcgatggtc
aacctcaagcacgagctggccgccgagaccgggctgcccgagtggcggatcgagcacctg
ctcggccgttacggctcgcagctgcacgaggtgctggcgctgtccgaggacgacccgtca
ctgctcgagcccgtcaaggacgccgagcagtacctccgggctgagctgaagtacgccgtc
acccacgaaggtgcactgcacctcgctgacgtcctcgcccgtcgtacgcgcatgtccatc
gagaccaagcaccgcggggtcggcgctgccgaggaggccgccgcgatcatggctccggtc
ctgaagtggtccaaggccaaggtcaaggacgagatcacggcctacgccgagcgggtgaag
gccgagcgcgcgtcgcaggagctggacaccgacgaggccagcgacgccgcacgcggcgag
gcacccgagacccgccccggcctgcgcgacgtcaccgccaccacctga

DBGET integrated database retrieval system