KEGG   Listeria monocytogenes J1816 (serotype 4b): LM220_19675Help
Entry
LM220_19675       CDS       T02776                                 

Definition
(GenBank) preprotein translocase subunit SecD
  KO
K12257  SecD/SecF fusion protein
Organism
lmoj  Listeria monocytogenes J1816 (serotype 4b)
Pathway
lmoj02024  Quorum sensing
lmoj03060  Protein export
lmoj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    LM220_19675
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LM220_19675
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LM220_19675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmoj02044]
    LM220_19675
Secretion system [BR:lmoj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   LM220_19675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG MMPL Carm_PH
Motif
Other DBs
NCBI-ProteinID: AGR32771
LinkDB All DBs
Position
2531493..2533757
Genome map
AA seq 754 aa AA seqDB search
MVKKSKIVIFFLVVAIIFGAVFGTAKMVMQNINLGLDLQGGFEVLYEVSPADGKGTVSKQ
TLTDTVTSLDKRINSLGVAEPSIQIEGDNRIRVQLAGVTDQEEARKMLSTTAQLSFRDAN
DKMMMNGSDLVAGGAKQAFDSSNNPIVTLKLKSADKFASVTKTILAEAPDNQLVIWLDWK
EGQKYKTEREKKDPAYLSAPNVSSVLDTDKVEISGSFTTEEAKDLADLLNSGALPVKMKE
VYSTSVGAQFGQDALQETILAGIIGVIAIFIFMMAVYRLPGVIACITLVAYTYLVLLILS
LLNATLTLPGIAGLILGIGMAVDANVITYERIKEEIKVGRSTKAAFEVGGKEAFRAILDG
NLTTLIVAAVLFYFGTSSIKGFATVLIISILVSFLTAVWGSRFLLGLLVKSNWLNNKPGF
FAVKRKDIHNLHEGINSFSLKTHFDRFDFVKHHRLFLSIFAAIVIVGIVILSIFRLNLGI
DFASGTRAEVTANQTLTETQIKKDLDAINMPSDDIVFQGSGSKTAVVSYKGTLSQNDVAK
FKNYFEDKYKHEPSISTVSPTVGKELAKNGFWALGVASVLIVLYIAVRFEFYMGIAAILS
LLFDAFIIFIFFSVTRLEVDLTFIAAVLTVIGYSINDTIVTADRIRDISMKMQRFKTKEE
IANAVNKALRQTFTRSINTILTVIFTVLALVLFGSESILNFSIALLVGLVSSVFSSIFMA
MQLWYVFKARQLRKKGPISTVKKKKPRNNGQPVV
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagagtaagatagttattttctttctagtagttgcaattatctttggtgct
gtatttggtaccgcaaaaatggttatgcaaaacatcaacctaggcttggatcttcaaggg
ggattcgaagttctatatgaagtttcaccagctgatggcaaaggaactgtatccaaacaa
acattgacagatacggtaacttcactcgacaagcgtatcaattcattaggtgtagctgaa
ccaagtattcaaatcgaaggggataaccgtattcgtgttcaacttgctggggtaactgat
caggaagaagcacgaaaaatgctatcaaccacagcccaattatcatttagagatgcaaat
gacaagatgatgatgaatggtagtgacttagttgcgggcggtgccaaacaagctttcgat
tcaagcaacaacccaatcgttacgctaaaactaaaaagtgcagataaatttgctagtgta
acaaaaacaatactagcggaagcgcctgacaatcaattagttatttggttagattggaaa
gaaggacaaaaatacaaaacagaacgcgagaagaaagacccagcttacttatcagcacca
aacgttagtagcgtgcttgatacagataaagtagaaatttccggaagtttcacaacggaa
gaagcaaaagatttagctgatttgctaaactctggtgcactccctgttaaaatgaaagaa
gtttactcgacatctgttggtgctcaatttgggcaagatgcgttacaagaaacaatttta
gctggtattattggggtcattgctatctttattttcatgatggcagtttaccgtttacca
ggcgttattgcttgtatcactttagttgcatacacttatttagtactattaatactgagt
ctgcttaacgcaacacttactttaccagggattgcaggtttgattctggggataggtatg
gctgttgacgcgaacgtaataacctacgagcggataaaagaagaaatcaaagtcggtagg
tcgacgaaagcggcttttgaggtcggcggtaaagaagcattccgtgcgattttagatggt
aacttgacgacacttatcgtagctgcggttctcttctactttggaacaagctccatcaaa
ggttttgctacggttctaatcattagtattttagtcagcttcttgacagccgtttgggga
tcaagattcttattaggcttattagtgaaaagtaattggcttaacaataaaccaggattc
tttgcagttaaacgaaaagatattcataatttacatgagggaattaatagctttagctta
aaaacacactttgatcgctttgattttgtaaaacatcatcgtctgttcttatctattttt
gctgcaattgttattgtcggtattgttattctctccatatttaggctaaatctaggtatt
gactttgccagtgggacacgagcggaagtaacagctaatcaaacgctgacagaaacgcaa
attaagaaagatttagatgcgattaatatgccatcggatgatattgttttccaaggatca
gggtctaaaacagccgttgtttcttataaagggacattatcacaaaatgatgtagctaaa
tttaaaaactattttgaggacaagtataagcacgaaccaagcattagtaccgtttcacca
actgtcggtaaagaacttgccaaaaatggcttctgggcactcggtgtggcgtctgtgctg
attgtactttatattgcagtccggtttgaattttatatgggtattgcggcgattctgtcc
ttactattcgacgcatttatcatcttcatattcttcagtgtaacaaggctggaggttgac
ttaaccttcattgccgcggtgctgacggttatcggttattccattaatgacacgatagtc
accgccgaccggatacgggatattagtatgaagatgcaacgtttcaaaacgaaagaagaa
attgcgaatgcggttaataaagcattacgccaaacattcactcgttcaattaataccatt
ttaacggttattttcaccgtactggcacttgtactatttggtagtgagtctattctgaac
ttctccatcgccttacttgttggacttgtttcgagtgtattctcctccatctttatggca
atgcaattgtggtacgtattcaaagcacgacaactacgaaaaaaaggcccaattagcaca
gttaaaaagaaaaaaccacgtaataacgggcaacctgtcgtataa

DBGET integrated database retrieval system