KEGG   Listeria monocytogenes J1816 (serotype 4b): LM220_19830Help
Entry
LM220_19830       CDS       T02776                                 

Definition
(GenBank) anthranilate synthase subunit I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
lmoj  Listeria monocytogenes J1816 (serotype 4b)
Pathway
lmoj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmoj01100  Metabolic pathways
lmoj01110  Biosynthesis of secondary metabolites
lmoj01130  Biosynthesis of antibiotics
lmoj01230  Biosynthesis of amino acids
lmoj02024  Quorum sensing
Module
lmoj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LM220_19830
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    LM220_19830
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LM220_19830
Enzymes [BR:lmoj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     LM220_19830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N DUF494
Motif
Other DBs
NCBI-ProteinID: AGR32802
LinkDB All DBs
Position
2420882..2422246
Genome map
AA seq 454 aa AA seqDB search
MRKTKKIDADTLTAILAFQRLSGTGKSLLEGAAKDAEAGRYSIIAINPVHEIKVYQHDYY
IDGIHQVVADPLKEIELFIEKAKEDEADLPLDSGAIGYVGYDVIALYENLGEIPVETRDM
PDIRFYVYESFVIMDHQAEELILVQDNCYSGRSEAELDKALELMFTELTTPKKEEHKAVH
VPKMTYKSNYTKEEYMGLVKKAKTYIQEGDFFQIVLSQRLEADFTVTPFDYYRKLRLLNP
SPYLYFIDFGDTVLIGSSPESLIKTKGRTVITNPIAGTRRRGATKQEDELLASELLSDEK
ELAEHRMLVDLGRNDIGKIAETGSVHVPVYLTIERYRFLMHLVSVVEGTLKPGLTAMDAL
RSTLPAGTVSGAPKIRAMERIYEWENVKRGPYAGAVGYLTKNGDSDFALSIRTMVLHNGK
AYVQAGAGIVYDSDPESEYLETLQKAKALLEVGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacgaaaaaaatagatgctgacacactaacggctattctggcgtttcaaaga
ctttcaggtacaggaaaaagtttgctagagggggcggcgaaagatgcggaggctggacgt
tattcgattattgccattaatccagtccatgaaattaaagtatatcaacatgattattat
atcgacggtatacatcaagttgtcgcagatcctttaaaagaaattgaattatttatcgaa
aaagcaaaagaagatgaagcagatttaccgcttgattcaggtgcaattggttatgttggt
tatgatgtcattgcgctttatgagaatttaggcgaaattccagtagaaactcgggatatg
ccagatattcgtttttatgtatatgaaagttttgtgattatggatcatcaggcggaagaa
cttattttagtgcaagataattgctattcgggaagaagtgaggcggaactagataaggcg
cttgaattaatgtttactgaacttacaacgccgaaaaaggaagagcacaaggctgtccat
gttcccaaaatgacatacaagagtaactacacgaaagaggagtacatggggttagtgaaa
aaagcaaaaacctatatccaagagggtgacttctttcaaattgttctctcgcaacgacta
gaagcagatttcaccgtgacaccatttgattattatcggaaattacgtttattaaatcct
tctccttatctttatttcattgattttggggatacggtgttgattggatcttccccagaa
agtttgatcaaaacaaaagggcggacggtaattacgaatcctattgcaggaacaagacgg
cgcggggcaacgaaacaagaagacgaactactcgcttcggaattgttgtcggatgaaaaa
gaattagcagagcaccgaatgttagtagatcttggacgaaatgatattgggaaaatcgcc
gaaacgggatcagtgcatgtgcctgtttaccttactattgaaagataccgtttcttaatg
catttagtttcagtagtagaaggaaccttaaaacccggacttactgcaatggatgctctt
cggtcgacgcttccggctggtacagttagcggagcaccgaaaataagagccatggagcga
atctatgaatgggaaaatgtaaaacgtggcccatatgctggtgcggttggttatttaact
aaaaatggtgattcggatttcgcgctttcgattagaacaatggtacttcataacggaaaa
gcttatgttcaagctggtgcaggaattgtctatgattccgatccagaaagcgaatactta
gaaacattacaaaaagcaaaggcacttttggaggtgggagaatga

DBGET integrated database retrieval system