KEGG   Listeria monocytogenes NE dc2014: CQ02_09105Help
Entry
CQ02_09105        CDS       T03477                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lmok  Listeria monocytogenes NE dc2014
Pathway
lmok00970  Aminoacyl-tRNA biosynthesis
lmok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmok00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CQ02_09105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmok03029]
    CQ02_09105
Enzymes [BR:lmok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CQ02_09105
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CQ02_09105
Mitochondrial biogenesis [BR:lmok03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CQ02_09105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1
Motif
Other DBs
NCBI-ProteinID: AHN32997
UniProt: A0A0B8RF45
LinkDB All DBs
Position
complement(1803166..1804596)
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGM
KAAMAINCEIAKHTKFDRKNYFYPDNPKAYQISQFDKPIGEHGWIEIEVGGKKKKIGITR
LHLEEDAGKNTHTSHGYSLVDINRQGTPLIEIVSEPDIRSAEEAYAYLEKLKSIIQYTGV
SDVKMEEGSMRCDANISIRPIGQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEVLKSGG
IIEQETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERIRAEIPELPDKR
QIRYINDLGLPAYDAMVLTLTKEMSDFFEATLAAGADAKQASNWLMGEVSAYLNAEQKEL
HETGLTPENLAGMIKLIEAGTISSKIAKKVFRELAQNGGDAEQVVKDKGLVQISDEGALR
TIISEILDNNEQSIVDFKNGKDRAVGFLVGQVMKATKGQANPPMVNKLLLEEMNKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagttattggacttgaggttcacgtagagttaaaaaccaattcaaaa
atattttcttctgcgccagctcattttggagcagaaccaaatacaaatacaaccgtggta
gacttaggtatgccaggtgttttaccagttttaaataaacgtgcagtggaatttggtatg
aaagcggctatggcgattaactgtgaaattgctaaacatacaaaattcgaccgtaaaaac
tatttttatccagataatccgaaagcataccaaatttctcaattcgataaaccaattggc
gaacatggctggattgaaatcgaagttggcggtaaaaagaaaaaaattggcatcactcgt
cttcatttagaagaagatgctgggaaaaatacccatacttctcatggttattcgttagtg
gatattaaccgtcaaggaacaccacttatcgaaatcgtttcagaaccagacattcgttct
gcagaagaagcttatgcctacttagaaaaattaaaatctatcattcaatacactggcgta
tccgatgtgaaaatggaagaaggttcaatgcgctgtgacgccaatatttctatccgacca
atcggccaagaagaatttggcgtaaaaacagaacttaaaaacctaaactccttcaacaac
gtacgtaaaggtatcgaatatgaagaaaaacgccaagctgaagtgcttaagtctggcggg
attatcgaacaagaaactcgtcgttttgaagaagcaactggaaaaacctctttgatgcga
attaaagaaggatccgacgattatcgttatttcccagaaccagatttagtagatttattt
attgatgacgcttggaaagaacgtattcgtgcagaaattcctgaacttccagacaaacgt
caaattcgttacattaacgatcttggtttgccagcatatgatgcaatggttctcacgctt
acaaaagaaatgtctgacttttttgaagcaactcttgcagctggagcagatgcgaaacaa
gcatcaaactggctaatgggcgaagtttctgcctacttaaacgcagaacaaaaagaactt
catgaaacaggactaactcctgaaaaccttgctggcatgattaaattaatcgaagctggt
actatttcttctaaaatcgctaaaaaagttttccgcgaattagcgcaaaatggtggcgat
gcagagcaagtagtaaaagacaaaggacttgtccaaatttccgatgaaggagctttacgc
actatcattagcgaaattctagataacaatgagcaatccattgtcgacttcaaaaatggt
aaggatcgtgcggttggattcttagttggccaagtaatgaaagcaaccaaagggcaagca
aacccaccaatggttaataaattattactagaagaaatgaacaaacgttaa

DBGET integrated database retrieval system