KEGG   Listeria monocytogenes NE dc2014: CQ02_09990Help
Entry
CQ02_09990        CDS       T03477                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
lmok  Listeria monocytogenes NE dc2014
Pathway
lmok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmok01100  Metabolic pathways
lmok01110  Biosynthesis of secondary metabolites
lmok01130  Biosynthesis of antibiotics
lmok01230  Biosynthesis of amino acids
Module
lmok_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lmok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CQ02_09990
Enzymes [BR:lmok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     CQ02_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH SBP_bac_3 YcgL Bromo_TP_like Mut7-C
Motif
Other DBs
NCBI-ProteinID: AHN33171
UniProt: A0A0B8R8P1
LinkDB All DBs
Position
complement(1982659..1983756)
Genome map
AA seq 365 aa AA seqDB search
MPEITVRAKSKTYPVYINEFALEDVREKWTESLAKFSHVFVLTDEHVAELHQAKLDAVLA
DLPVVTYYVAPNGEEAKTFRVYEDVMTKLIETGLDRKAVLIAFGGGVIGDLGGFVAATYM
RGIPFYQVPTTVLAHDSAVGGKVAINHPLGKNMIGNFYQPEAVIYDTQFFATLPEREMRS
GFAEMIKHALISDQTLLRALMDTFTEPKDFYTKDLTPFLQRGIEIKANIVAQDETEQGVR
AYLNFGHTFGHALEAYGNFGKWLHGEAITYGMIYALTMSETIYGLDFDLAEFKTWLKQLG
YDTTFDATVPFNKILENMRHDKKTTFNEISMVLLEEIGEPVIFKAEDDLIFETYKRVMRN
GGNGI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaattacagtccgtgctaaaagtaaaacatacccagtatatattaatgaattc
gcattagaagatgtccgggaaaagtggacggagagcctagctaaattttcccacgtgttt
gttttgacggacgagcatgtggcggaacttcatcaagcaaagcttgacgcggttctagct
gatttacctgtagtcacttattatgtggcgccaaacggggaagaagcgaaaacgtttcgt
gtatatgaagatgtgatgacaaaattgattgaaacaggtcttgatcgtaaagcggtttta
attgcttttggtggaggcgttattggtgatttaggtggttttgttgcggctacgtatatg
aggggcattcctttttatcaggtgcctacgacggttcttgcgcatgatagtgccgtgggt
ggcaaggttgcgatcaatcatccgcttggcaaaaacatgattgggaacttttaccagcca
gaagcagtcatttatgatacccagttctttgctactttgccagaacgggaaatgcgctct
ggttttgcggaaatgattaaacatgcgcttattagcgatcagacgttactacgggcctta
atggatacatttacggagccgaaagacttttatacgaaggatttgacgccgtttttacaa
cgtgggattgaaattaaagcaaatatcgttgcgcaagatgaaaccgagcaaggcgtgcgc
gcttatttgaattttggtcacacatttggtcatgcacttgaagcctacggaaactttggc
aagtggctgcacggcgaggcgattacttatgggatgatttatgcactcacgatgagtgag
acaatttacggactggatttcgatttagcagaatttaaaacgtggctaaaacagttaggc
tatgatacgacatttgatgcaactgttccatttaataaaatactggaaaatatgcgtcat
gataaaaaaacaacttttaatgaaataagtatggttttactcgaagaaattggagaaccg
gttatttttaaagcggaagatgatttgatttttgaaacttacaaacgtgtgatgcgaaat
ggagggaatggcatttga

DBGET integrated database retrieval system