KEGG   Listeria monocytogenes NE dc2014: CQ02_11915Help
Entry
CQ02_11915        CDS       T03477                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmok  Listeria monocytogenes NE dc2014
Pathway
lmok00250  Alanine, aspartate and glutamate metabolism
lmok00410  beta-Alanine metabolism
lmok00430  Taurine and hypotaurine metabolism
lmok00650  Butanoate metabolism
lmok01100  Metabolic pathways
lmok01110  Biosynthesis of secondary metabolites
lmok01120  Microbial metabolism in diverse environments
lmok02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CQ02_11915
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CQ02_11915
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CQ02_11915
   00430 Taurine and hypotaurine metabolism
    CQ02_11915
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CQ02_11915
Enzymes [BR:lmok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CQ02_11915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AHN33541
UniProt: A0A0B8R264
LinkDB All DBs
Position
2386173..2387567
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKNQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactagaacctcggattgcc
tatcgtttagtgaaagacgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgagtacccaagaacagctgaactagaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaagaaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgctgggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcctctggc
taccaagtgtgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagatcacatgcaactgaataccgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctac
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatattatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
cctggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaacttattttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcatcaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgcgctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgctcacatcctcttccatgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system