KEGG   Listeria monocytogenes L312 (serotype 4b): LMOL312_0317Help
Entry
LMOL312_0317      CDS       T02247                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmol  Listeria monocytogenes L312 (serotype 4b)
Pathway
lmol00010  Glycolysis / Gluconeogenesis
lmol00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOL312_0317
   00500 Starch and sucrose metabolism
    LMOL312_0317
Enzymes [BR:lmol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOL312_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: CBY66395
LinkDB All DBs
Position
complement(341495..342910)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccaactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggatttggtcacattactgacggtccaacaccagataacttaaaattagaagga
attgacttctatcatcgctacaaagatgatgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggattacaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctcactttcaatgaaatcaactccattttacac
gcaccattcatgagcggcggtatttctacaagcccagataaattatctcaaaaagactta
tatcaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcccaaatcggctgcatggtcctagcaatgccaacttatccgctaact
tccaacccagatgatattattgctgttatggaagcagagcgcaaaaactacttcttctcc
gacgttcatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcaaaacgcaaagctggc
gcaggaaacatcctaggcggcgtgcaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttgcgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgatgactaccgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaaaaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system