KEGG   Listeria monocytogenes L312 (serotype 4b): LMOL312_2630Help
Entry
LMOL312_2630      CDS       T02247                                 

Definition
(GenBank) polyol dehydrogenase, zinc-dependent
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmol  Listeria monocytogenes L312 (serotype 4b)
Pathway
lmol00040  Pentose and glucuronate interconversions
lmol00051  Fructose and mannose metabolism
lmol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOL312_2630
   00051 Fructose and mannose metabolism
    LMOL312_2630
Enzymes [BR:lmol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMOL312_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ApbA TrkA_N UDPG_MGDP_dh_N 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: CBY68708
LinkDB All DBs
Position
complement(2708551..2709603)
Genome map
AA seq 350 aa AA seqDB search
MRAAVLYENNVIKAEQIDEATCGKDQVRVEVKAVGICGSDIHKMQTRWKYPLPAVMGHEF
AGVVTEIGSEVTNVAIGDRVAGIPLEPCMECNYCKAGDFALCDNYRMVGSHFHGGFAENV
VMKADNVISIGDLDFEEGAMIEPLAVSMHGVLGIQPRLGDTVIVFGIGTIGILVVQCLLL
AGVKDIIAVDISDKKLADAREFGCKYTINPKNEDLKERVFAYTNGLGADIALECAGSKIT
QEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTLKGFWNSYSAPFPGEEWRTS
IEFVKQGRIKLKPLISHRYKLEETKEAFDMILSREHDYNKVMILPQKGDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagctgtgttatacgagaataatgtaataaaagcagaacaaattgatgaagcg
acttgtgggaaagatcaagttcgtgtcgaagtaaaagcagtcggaatatgcggatcagat
attcataaaatgcagactcgctggaaatacccactgcctgctgtaatgggacatgaattc
gcaggtgtagttacggaaattggtagcgaagtaacaaacgtagctattggtgaccgtgtt
gcagggattccgctcgagccttgtatggaatgtaattattgtaaagcgggcgactttgca
ttatgtgacaactaccggatggtgggatcacattttcacggcggatttgctgaaaatgtc
gtcatgaaagccgacaatgtcatttctatcggcgaccttgattttgaagaaggtgcgatg
attgaaccacttgctgtatcaatgcacggagtacttggtattcagccgagacttggcgat
acggtgattgtcttcggaattggaaccatcggaatcttggttgtacaatgcttacttctt
gcgggagtaaaagatattatcgcggttgatatcagtgataaaaagttagcagacgcgcgg
gaattcggttgtaaatacaccattaatccaaaaaatgaagacttaaaagaacgcgttttt
gcttatacaaatggtcttggggcagatatagcgctcgagtgtgctggttccaaaataacg
caagaacaatgtcttcttgtaacaaagaaaaaaggtaaagttggttttctaggaatagct
tacgcagatgtgcttttacacgaggaagcttttgaaaatatttttagacgtgaacttacg
ctgaaaggtttttggaattcttactcggcaccatttccaggtgaggagtggcgtacgtcg
attgaattcgtgaaacaaggtcgaattaaactgaaaccactaatttcgcatcgttataag
ctagaagaaacgaaagaagcttttgatatgattctttccagagagcatgattataacaaa
gtgatgatattgccgcagaaaggtgacgattaa

DBGET integrated database retrieval system