KEGG   Listeria monocytogenes Lm60 (serotype 1/2a): IJ09_00190Help
Entry
IJ09_00190        CDS       T03479                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Pathway
lmom00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmom01100  Metabolic pathways
lmom01110  Biosynthesis of secondary metabolites
lmom01130  Biosynthesis of antibiotics
lmom01230  Biosynthesis of amino acids
Module
lmom_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IJ09_00190
Enzymes [BR:lmom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     IJ09_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt PspC
Motif
Other DBs
NCBI-ProteinID: AIL66236
UniProt: A0A3D7WI56
LinkDB All DBs
Position
33739..34905
Genome map
AA seq 388 aa AA seqDB search
MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITA
GIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYG
HNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVAEI
QETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLD
AKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTN
GMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAV
AVLEKFDGDRFDTLKKHVEEHRNLTKEF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagatacttaacggcaggagaatcacacggaccggggcttacaacaattattgagggg
ttaccagcaggaatgcctctactagcagaagatgtaaacaaagaactaaaaagaagacaa
ggtgggcatggtcgtggggcgcggatgcgtatcgaaaaagaccaagtacaaatcacggca
ggaattcgtcacggaaaaacattaggcgcacccgtagcaatgtttgttgaaaataaagac
tggaagcattgggaaacggttatgagcattgaaccagttccagaaaaaaatgaaaagtct
cgtcgcgtatcccgtccacgtcctggacatgcggatttggttggcggcatgaaatatggt
cataacgatatgcgtaatgtactagaacgttctagcgcgcgcgaaacgactgttcgcgtg
gcagcaggagcagtagcgaaaaaactattgcacgaacttggcattgaagttgccggccat
gtacttgaaattggcggaacgcgtgcgaatttaacacgtgattacgcggttgcagaaatc
caagaaacatccgaagcttccccagttcgttgtctagacggcgtggctgcagaagaaatg
atgcaaaaaattgatgacgcgaagaaaaatggcgacacaattggtggaattgttgaagtt
gttgttggcggcgtgccagctggacttggtagttacgtacaatgggacaaaaaattagat
gcgaaaattgctcgcgcgattgtaagtatcaatgcatttaaaggtgctgaattcggtgtc
ggttttgaagccgctagaaaacctggtagcgaagtgatggatgaaattttatggagtaaa
gaagatggctacactagacgtacaaacaatcttggtggtttcgaaggcggaatgaccaat
ggtatgccaatcgttgttcgcggcgtaatgaagccaattccaacattatacaaaccactt
caaagcgtggatattgattcaaaagaaacgtttaatgcaagtgtagaacgttcggatagt
tgtgcagtacctgctgcaagcgtagtagctgaagctgttgtcgcttgggaagttgcagta
gctgttttagaaaaatttgatggtgatcgttttgatacgcttaaaaaacatgtggaggaa
caccgaaacttaacgaaggagttttaa

DBGET integrated database retrieval system