KEGG   Listeria monocytogenes Lm60 (serotype 1/2a): IJ09_08700Help
Entry
IJ09_08700        CDS       T03479                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Pathway
lmom00010  Glycolysis / Gluconeogenesis
lmom00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IJ09_08700
   00500 Starch and sucrose metabolism
    IJ09_08700
Enzymes [BR:lmom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     IJ09_08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: AIL67865
LinkDB All DBs
Position
1706202..1707617
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccggccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
atcgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggacttcaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactcgattttacat
gcaccattcatgagcggtggtatttctacaagcccagataaattatctcaaaaagaccta
taccaagctgtccaccacgaacttgtggcaagcgcactggcaacaaaaatcggtcacgaa
atcatgccagaagctcaaatcggctgcatggttctagcaatgccaacctatccgctaact
tcccatcccgatgatattatcgctgttatggaagcagagcgcaaaaactacttcttctcc
gatgtccatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatacttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtacaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgttgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aaaaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system