KEGG   Listeria monocytogenes Lm60 (serotype 1/2a): IJ09_09240Help
Entry
IJ09_09240        CDS       T03479                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Pathway
lmom00790  Folate biosynthesis
lmom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IJ09_09240
Enzymes [BR:lmom01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     IJ09_09240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase DUF3783
Motif
Other DBs
NCBI-ProteinID: AIL67956
UniProt: A0A3T2I5Y7
LinkDB All DBs
Position
complement(1816373..1817188)
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMVEDGAAIIDVGGISTRPG
FSEVTPDEELARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEP
KIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatggggatattgaatgttacgcca
gattctttttcagatggcgggaaatatatgcaagtagaagaagcggtggctcgagcgtta
caaatggtggaagatggagcagcgattattgacgttggaggaatatctactcgtcctggt
ttttcggaagtaacccccgatgaagaacttgcccgaattataccggtcattaaagctgtc
aggacgaaattacccgatatatggatttccgttgattcttggcgtgctgaagtagcggaa
caggctatcttagcgggagctgatatgataaatgaccagtggggtgcgaaaaaagaaccg
aaaattgccgaagttgctgcaaaatacgatgtaccgatttgtttaatgcacaatcgtgag
aacgcgcaatacgacaattttttagaagatgtgaaaaaagacttgttagaaagtattgcc
atagctaaagcagcatcagtaccagacgagcatattattctcgatccaggttttggtttt
gttaagacacctgctcagaatttagaagtgttacgacggattgatgagatagtcgcactt
ggttacgaggttttactcggtacgagcaggaagtcaactattgggctcgtcctaggaact
actcctggagatagaatggaaggaactggagcaacaactgtctatggattttcgaaaggt
tgtacaattactcgtgtccatgatgtacttccaattgcacgtatggtgcgaatgacagat
gcaatcactggcaaattagatattacaaatttataa

DBGET integrated database retrieval system