KEGG   Listeria monocytogenes Lm60: IJ09_13085Help
Entry
IJ09_13085        CDS       T03479                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Pathway
lmom00250  Alanine, aspartate and glutamate metabolism
lmom00410  beta-Alanine metabolism
lmom00430  Taurine and hypotaurine metabolism
lmom00650  Butanoate metabolism
lmom01100  Metabolic pathways
lmom01110  Biosynthesis of secondary metabolites
lmom01120  Microbial metabolism in diverse environments
lmom02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IJ09_13085
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IJ09_13085
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IJ09_13085
   00430 Taurine and hypotaurine metabolism
    IJ09_13085
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    IJ09_13085
Enzymes [BR:lmom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     IJ09_13085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AIL68672
LinkDB All DBs
Position
complement(2559513..2560907)
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKEHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIFNDGSHLPIVCYKLKKDANVKWTLYDLADRLQMRGWQVPAYPLPKSLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccactcgaacctcggattgct
taccgtttagtgaaagacgaacttttagatgaaggttccgcccgccaaaacctagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgaatacccaagaacagctgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaatttatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gccgaaaaacttggcctagatatttatgcaaaaaaaccaaatctcgttatctcctctggc
taccaagtgtgttgggaaaaattctgtgtttactgggatatcgatatgcgcgttgttcca
atggataaagagcacatgcaactcaataccgatcaagtccttgattacgtcgatgaatat
acaatcggtgtggtcggcatcctcggtatcacttacacaggccgctatgatgacatctac
gcgctaaatgaaaaacttgaagaatacaatagcaaaaccgattataaagtctacattcac
gtcgatgcagctagtggaggtttcttcactccatttgtcgaacctgacattatctgggac
ttccgtttgaaaaacgttatctcaattaatacttccggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcattttt
aaagtcagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgtagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaactagcgacgtcgcacaataccttgctcacgcagtcgaacaaactggc
tactttgacatttttaacgatggctcccacttaccaatcgtctgctataaattaaaaaaa
gacgctaatgtaaaatggacattatacgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatatccactaccaaaaagcttggaaaacattattattcaacgttacgtc
tgccgcgctgaccttggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacatccttttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system