KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_0823Help
Entry
LMOSLCC2376_0823  CDS       T02222                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmon  Listeria monocytogenes SLCC2376 (serotype 4c)
Pathway
lmon00473  D-Alanine metabolism
lmon00550  Peptidoglycan biosynthesis
lmon01100  Metabolic pathways
lmon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMOSLCC2376_0823 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMOSLCC2376_0823 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LMOSLCC2376_0823 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmon01011]
    LMOSLCC2376_0823 (ddlA)
Enzymes [BR:lmon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LMOSLCC2376_0823 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lmon01011]
 Precursor biosynthesis
  Amino acid ligase
   LMOSLCC2376_0823 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF2922
Motif
Other DBs
NCBI-ProteinID: CBY62855
LinkDB All DBs
Position
860536..861648
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQAEMITEMEEVL
TYPVFVKPANLGSSVGISKATNKKELADAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVAPEILEQMKEYAVQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattaattttgttatacggtgggaaatctgctgaacacgaagtttcctta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tatattacgaatgaaggtgagtggattcaaggaccacttctttctgggaagttagatttt
gtcgaacaattacgtttttcggctacagatacaataaaacttgctacaactgaatcagaa
aaatcagaaggggaagcgattagcccggccgttttagaagcagacggacaagagacagtc
gtattcccacttttacatggtccaaacggagaagatggcactgttcaaggattgttcgaa
gtattaaacattccatatgttggcaacggggtcttggcatcttctgctgcaatggacaaa
atcgtgatgaagaaaatttttgcagacgctggtattccgcaagttccagcagttgcagtg
cgtttaattgattggaaaaactatcaagcagaaatgattacggagatggaagaagtactt
acctatccagtcttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acaaacaaaaaagaattagcagacgcaatgacagaagcgtttttatatgaccgtcgtgtt
gttgttgaacaaggtgttgttgcgcgcgaaatcgaaatgggcgtacttggaaatgatacg
ccagtttgctctgttccaggtgaaattttgccagaaggtgcagttgctacgttttacgat
tacaaagcaaaataccaggataataatactgcgttaattattccgactgaagtagctccg
gaaatcttggaacaaatgaaagaatatgcggttcaagcattcctaggtcttgatgcaagc
ggactagtgcgagcggactttttcttaacggaagataatcagttattcttaaatgaagtg
aatacaatgccaggtttcacaccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgttaattgaacgattagtcgatttagcgaaagaacgccacgcagcc
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system