KEGG   Listeria monocytogenes SLCC2376 (serotype 4c): LMOSLCC2376_1247Help
Entry
LMOSLCC2376_1247  CDS       T02222                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, aerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmon  Listeria monocytogenes SLCC2376 (serotype 4c)
Pathway
lmon00564  Glycerophospholipid metabolism
lmon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMOSLCC2376_1247 (glpD)
Enzymes [BR:lmon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LMOSLCC2376_1247 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CBY63279
LinkDB All DBs
Position
1268604..1270280
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIVGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDNKQVVGVTVTDRLSGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHITEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDDVSKSLAKETGKKYKPVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREMAKRFGSNIDQLFTYAQEHKEQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcatttgacagagaaacaatcgaacgaaatctacaagaggaa
aaatttgatttagtcatcgtcggtggcgggattacaggagcaggaatcgctttagatgca
acttcacgaggaatgagcgttgcgcttgttgaaatgggtgattttgcaagcggtacatca
agccgttcgacaaaactagtccacggaggactgcgatatttacaacaattcgaaatcaag
gaagtagcggatttaggaaaagaacgtgcaatagtctacgaaaatggacctcacgtaaca
actcctgaatggatgatgctcccattccataaaggcggcaacatgggcaaaacaactgct
tcattcgggattcgtttatatgattatttagcaggtgtaaagaaaaatgaacgccgcaaa
attttaagcgcaaaagaaactttagctaaaaatcctttcgtgaaaaaagatggattaaaa
ggctctggttactacgtagagtaccgtacagatgatgcgcgtttaacaatagaagtcatg
aagaaagcggtagaactcggagcaaatgccattaactatacaaaagcagagcatttctta
tacgatgacaataaacaagtagtcggcgtaactgtaacagaccgtttgtcaggtaaagca
tatgacattaaaggtcaccgcgttattaatgcagccggcccgtgggtggataaagtaaga
aaattagattatgcaacaaacaacaaacatttacgcttaacaaaaggaattcatttagtt
attgataaacaaaaattcccaatggaacaagcagtatactttgatacgcctgatggtcgc
atggtttttgctattccgcgtgataaaaaagtatacgtagggacaacggatacagtctat
gacgaagcagtaatcaatccaaaagcactcgaatccgatcataattatgtgattaaagcg
attaattatatgttccctgatgtgcatattaccgaaaaagacattgaatcaagttgggcc
ggagttcgtccacttatttatgaagaaggcaaagatccatccgaaatttctcgtaaagat
gaagtttggttttctgaaagtggcttaattacaatggctggtggtaaactcactggatac
agaaaaatggccgaaaaattattagatgatgtttctaaatcactagcaaaagaaaccggt
aaaaaatacaaaccagttcaaacaaaacatttgcctatttctggtggggatattggtggc
tcagaacaattagaagcatttctatcgaagaaagcgaaagaaggaaataatcgctttggt
tggacattagaagaaggtcgcgagatggcaaaacgttttggtagcaatatcgatcaattg
tttacgtacgcgcaagaacacaaagagcaaaacgaaaccactttgccaaacagtttatat
gcggaactacgttattcgattcaacacgaagcagtaacaacaccgattgatttcttatta
cgtcgtacaggctacttacttttcgatatgccatacttgcttgaatggaaagatgcggtt
gtagatgaaatggctaaacaattccactggagtgacgatgtaaaacaaacttatatagaa
gaattaaatatccaaattaatgatgctagagagccagctgattggcacgatagataa

DBGET integrated database retrieval system