KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_2258Help
Entry
LMOSLCC2376_2258  CDS       T02222                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00250  Alanine, aspartate and glutamate metabolism
lmon00410  beta-Alanine metabolism
lmon00430  Taurine and hypotaurine metabolism
lmon00650  Butanoate metabolism
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01120  Microbial metabolism in diverse environments
lmon02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC2376_2258 (gadG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2376_2258 (gadG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC2376_2258 (gadG)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2376_2258 (gadG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2376_2258 (gadG)
Enzymes [BR:lmon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC2376_2258 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CBY64290
LinkDB All DBs
Position
2328043..2329437
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDKYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANIKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHYTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccacttgaacctcggattgct
tatcgtttagtgaaagatgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcgatcgataaatctgaatacccaagaacagctgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaattcatgggaacttccacaatt
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcttctggc
tatcaagtttgctgggaaaaattctgtgtctactgggatattgatatgcgcgttgttcca
atggataaagaccacatgcaactaaatactgaccaagtccttgattacgtcgacaaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctat
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gttgatgcagcaagtggtggcttcttcacaccatttgtcgaacccgatatcatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcattttt
aaagtcagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcattggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtcgcacaataccttgcccacgcagtcgaacaaaccggc
tacttcgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacataaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgagctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaattaaacaacgcccacattctcttccactatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system