KEGG   Listeria monocytogenes SLCC2378 (serotype 4e): LMOSLCC2378_2672Help
Entry
LMOSLCC2378_2672  CDS       T02240                                 

Definition
(GenBank) polyol dehydrogenase, zinc-dependent
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmoo  Listeria monocytogenes SLCC2378 (serotype 4e)
Pathway
lmoo00040  Pentose and glucuronate interconversions
lmoo00051  Fructose and mannose metabolism
lmoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOSLCC2378_2672
   00051 Fructose and mannose metabolism
    LMOSLCC2378_2672
Enzymes [BR:lmoo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMOSLCC2378_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBY74439
LinkDB All DBs
Position
complement(2726065..2727096)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELRDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKERDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTDGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKINTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaaccccggatatgatcaaatggagctaagagatgtagaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagacatccatacgtttaaaggtgaatacaaaaatccaacaactcccgtcacactggga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacaagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagaatgtatttattgtaaggaa
cgtgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaagaaagttgtcacgtgcttgatgaacgtatttcgctc
gaagcagcagcactaacagaaccgcttgcatgttgtgtgcattcggcgcttgaaaaaaca
acgattcgtccagatgacacagtacttgttttcggaccaggtccaattggtttgttacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagt
gaccgcttacgtctagcaaaagagcttggaatggaccggattgtcgatactttaaaagaa
gacttggctgaagttgtgcttggcatgacagatggttacggagcggaacgcgtatttgat
tgttctggcgcagtacccgctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatccattatc
caacgtgaaattgcttatatcggcagccgttcgcaaaaaccatcttcttggattttagcg
ctcgacttactagcaaatggcaaaatcaatacggataaaatgattactaaagtatacggt
ttggatgactggcgcgaggctttcgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system