KEGG   Listeria monocytogenes 6179 (serotype 1/2a): LM6179_0618Help
Entry
LM6179_0618       CDS       T03159                                 

Gene name
bglH
Definition
(GenBank) aryl-phospho-beta-d-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoq  Listeria monocytogenes 6179 (serotype 1/2a)
Pathway
lmoq00010  Glycolysis / Gluconeogenesis
lmoq00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmoq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM6179_0618 (bglH)
   00500 Starch and sucrose metabolism
    LM6179_0618 (bglH)
Enzymes [BR:lmoq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LM6179_0618 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: CDM18881
LinkDB All DBs
Position
complement(622494..623909)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccggccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
atcgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggacttcaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactccattttacat
gcaccattcatgagcggcggtatttctacaagcccagataaattatctcaaaaagaccta
taccaagctgtccaccacgaacttgtagcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcacaaatcggctgcatggttctagcaatgccaacttatccgctaact
tcccatcccgatgacattatcgctgttatggaagctgagcgcaaaaactatttcttctcc
gacgttcatgttcgcggaacttatccgggctatatgaaacgctatttcagagaaaacaat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tctttcagctattacatgagcacaactgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtacaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgttgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aaaaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system