KEGG   Listeria monocytogenes 6179 (serotype 1/2a): LM6179_0874Help
Entry
LM6179_0874       CDS       T03159                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
lmoq  Listeria monocytogenes 6179 (serotype 1/2a)
Pathway
lmoq00340  Histidine metabolism
lmoq01100  Metabolic pathways
lmoq01110  Biosynthesis of secondary metabolites
lmoq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmoq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LM6179_0874 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: CDM19137
LinkDB All DBs
Position
complement(881025..882206)
Genome map
AA seq 393 aa AA seqDB search
MNLNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA
KLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKIFRANEDFGGEQNEQTQ
AGIEIIGYPSIKAEIECILIGIGVLNALEIPNFQIELGHAAIYRRVTNLLNLSETAEIDF
RLLIQNKSLTGIKRFVADNPSTLDDFILALPRLFGPATAILKQAKNLTTDKGILTALREM
ETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADNFLSGGRYDHLLEQFTSASS
PAVGLALNLDSLTTLQNRAGVIKKQVSTSLLIHYDLDAIQQAEKLMQETPNSELSFFETP
TNAISFAKKWHIPAVIHVSRQGIQTIFHREADL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaataagaacttaccaactggaacacgtgataaactttttcgtgaagcacga
gctgcatacaaaattgagcaacaagtgaatcattattttgaaaaacgcggatttaagcgg
attgaaacgcctgttatcgagtttgaagatgtcttttcctctgaacatcaagccgatgcg
aagttgtatcgtttctttgacgaaaaaggtcgcttgacggttcttaggccggatatgaca
cttccgattggtcgagttgttagtaccactggtgtgatgctccctctaaaactttcttat
agcggaaaaatttttcgcgcaaatgaagattttggtggcgaacaaaacgaacaaacgcaa
gccggtattgaaatcattggctacccttcgattaaagcagagattgaatgcattttgatt
gggattggagttttaaatgctctagaaattccgaattttcaaattgaactcggacatgca
gcaatttatagacgcgtaaccaaccttttaaatctctccgaaacagctgaaattgatttt
cgcttgctgattcagaataaaagtttaactggtattaagcgatttgtagccgataatccg
agtacgcttgacgatttcattttagcactaccacgattatttggaccagcgacagcgatt
ttaaaacaagccaaaaatttaacaacggacaaaggcattttaacggcactgcgtgaaatg
gaaaccattgtggaagctgtttcttacacagcagatattagtgtcgatttaggactcgtg
caagattttcattattatacaggtataatttttagaggatatgctgaccttgctgctgat
aattttttaagcggcggccgttacgatcacctcctagaacaattcaccagcgcttcctcc
ccagcagttggtttggctcttaatcttgactccctcacaaccctacaaaaccgcgctggc
gtcatcaaaaagcaagtttctacaagccttttaattcactacgacctagacgcaatccaa
caagcagaaaaactcatgcaagaaacaccaaatagcgaattaagtttttttgaaactccg
acaaacgctatctctttcgcgaaaaaatggcatattccagccgttatccatgtctcaagg
caaggcatccaaactatttttcacagggaggcagacttatga

DBGET integrated database retrieval system