KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_0306Help
Entry
LMOSLCC7179_0306  CDS       T02224                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos00010  Glycolysis / Gluconeogenesis
lmos00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_0306
   00500 Starch and sucrose metabolism
    LMOSLCC7179_0306
Enzymes [BR:lmos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC7179_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: CBY59512
LinkDB All DBs
Position
complement(335639..337054)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccggccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
atcgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggacttcaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactcgattttacat
gcaccattcatgagcggcggtatttctacaagcccagataaattatctcaaaaagaccta
taccaagctgtccaccacgaacttgtagcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcacaaatcggctgcatggttctagcaatgccaacttatccgctaact
tcccatcccgatgacattatcgctgttatggaagctgagcgcaaaaactatttcttctcc
gacgttcatgttcgcggaacttatccgggctatatgaaacgctatttcagagaaaacaat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tctttcagctattacatgagcacaactgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtgcaaaacccttacctagaagcatccgaatggggttgg
caaatcgatcctcaaggcttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgttgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aaaaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system